Cat.No. | ra-3915FB |
Availability |
Protein Name: | Pen ch 13 |
Source: | E.coli |
Species: | Penicillium chrysogenum |
MW: | 30.3 kDa |
Tag: | His |
Formulation: | 50mM Tris, 0.3M NaCl, 0.05% SKL, pH 8.5 |
Purity: | >90% by SDS-PAGE |
Storage: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration: | 0.5-1.0mg/mL |
GenBank Protein: | AAF23726 |
UniProt: | Q9URR2 |
Product Discription: | Recombinant biotinylation Pen ch 13 was expressed in E.coli with His tag. |
Sequence: | MGSSHHHHHHSSGLVPRGSHMANVVQSNVPSWGLARISSKRTGTTSYTYDSTAGEGVVFYGVDTGIDISHSDFGGRAKWGTNVVDNDNTDGNGHGTHTASTAAGSKYGVAKKATLVAVKVLGADGSGTNSGVISGMDWAVKDAKSRGANGKYVMNTSLGGEFSKAVNDAAANVVKSGIFLSVAAGNEAENASNSSPASAAEACTIAASTSTDGSASFTNFGSVVDLYAPGQSITAAYPGGGSKTLSGTSMAAPHVAGVAAYLMALEGVSAGNACARIVQLATSSISRAPSGTTSKLLYNGINV |
Catalog# | Product Name | Inquiry |
---|---|---|
ra-3915F | Recombinant Pen ch 13 | Inquiry |
ra-3914F | Recombinant Pen b 26 | Inquiry |
ra-3916FB | Recombinant Pen ch 18, Biotin Labeled | Inquiry |
ra-3923F | Recombinant Pen c 19 | Inquiry |
ra-3922F | Recombinant Pen c 13 | Inquiry |
ra-3921F | Recombinant Pen c 3 | Inquiry |
ra-3920F | Recombinant Pen ch 35 | Inquiry |
ra-3919F | Recombinant Pen ch 33 | Inquiry |
ra-3918F | Recombinant Pen ch 31 | Inquiry |
ra-3917F | Recombinant Pen ch 20 | Inquiry |
ra-3916F | Recombinant Pen ch 18 | Inquiry |
ra-3192A | Recombinant Pen a 1 | Inquiry |
ra-3913F | Recombinant Pen b 13 | Inquiry |
ra-3200A | Recombinant Pen m 13 | Inquiry |
ra-3199A | Recombinant Pen m 8 | Inquiry |
ra-3198A | Recombinant Pen m 6 | Inquiry |
ra-3197A | Recombinant Pen m 4 | Inquiry |
ra-3196A | Recombinant Pen m 3 | Inquiry |
ra-3195A | Recombinant Pen m 2 | Inquiry |
ra-3194A | Recombinant Pen m 1 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools