| Cat.No. | RA-3916FB |
| Availability |
| Protein Name: | Pen ch 18 |
| Source: | E.coli |
| Species: | Penicillium chrysogenum |
| Description: | Recombinant biotinylation Pen ch 18 was expressed in E.coli with His tag. |
| MW: | 35 kDa |
| Tag: | His |
| Formulation: | PBS, pH 7.4 |
| Purity: | >90% by SDS-PAGE |
| StoRAge: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal stoRAge. Avoid repeated freeze-thaw cycles. |
| ConcentRAtion: | 0.5-1.0mg/mL |
| GenBank Protein: | AAF71379 |
| UniProt: | Q9P8G3 |
| Sequence: | MGSSHHHHHHSSGLVPRGSHMSEGSVEKNAPWGLARISHRESLSFGNFNKYLY AEEGGEGVDAYVIDTGANVKHVDFEGRANWGKTIPQGDADEDGNGHGTHCSGTI AGKKFGVAKKANVYAVKVLRSNGSGTMSDVVKGVEWAAEAHIKKSKKGDKKFKG SVANMSLGGGSSRTLDLAVNAAVDAGIHFAVAAGNDNADACNYSPAAAEKAITVG ASTLADERAYFSNYGKCTDIFAPGLNILSTWVGSDHATNTISGTSMASPHIAGLLAY YVSLAPAKDSAYAVADVTPKQLKAALISVATEGTLTDIPSDTPNLLAWNGGGSANY TKILADGGY |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| RA-3916F | Recombinant Pen ch 18 Protein, N-His tagged | Inquiry |
| RA-3919F | Recombinant Pen ch 33 | Inquiry |
| RA-3192A | Recombinant Pen a 1 | Inquiry |
| RA-3193A | Recombinant Pen i 1 | Inquiry |
| RA-3913F | Recombinant Pen b 13 | Inquiry |
| RA-3914F | Recombinant Pen b 26 | Inquiry |
| RA-3194A | Recombinant Pen m 1 | Inquiry |
| RA-3198A | Recombinant Pen m 6 Protein, C-His tagged | Inquiry |
| RA-3200A | Recombinant Pen m 13 Protein, C-His tagged | Inquiry |
| RA-3918F | Recombinant Pen ch 31 | Inquiry |
| RA-3922F | Recombinant Pen c 13 | Inquiry |
| RA-3196A | Recombinant Pen m 3 | Inquiry |
| RA-3195A | Recombinant Pen m 2 Protein, C-His tagged | Inquiry |
| RA-3917F | Recombinant Pen ch 20 | Inquiry |
| RA-3197A | Recombinant Pen m 4 | Inquiry |
| RA-3921F | Recombinant Pen c 3 | Inquiry |
| RA-3923F | Recombinant Pen c 19 | Inquiry |
| RA-3199A | Recombinant Pen m 8 | Inquiry |
| RA-3915F | Recombinant Pen ch 13 Protein, N-His tagged | Inquiry |
| RA-3920F | Recombinant Pen ch 35 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools