| Cat.No. | RA-3195A |
| Availability | |
| Size | 500ug1mg |
| Price | $ |
| Qty |
| Source: | E.coli |
| ShortName: | Pen m 2, C-His tagged |
| similar: | Pen m 2 |
| Tag: | C-His |
| Product Overview: | Recombinant Pen m 2 Protein with C-His tag was expressed in E.coli. |
| Form: | Sterile PBS, pH 7.4 |
| Molecular Mass: | 40 kDa |
| AASequence: | MADAAVIEKLEAGFKKLEAATDCKSLLKKYLSKAVFDQLKEKKTSLGATLLDVIQSGVENLDSGVGIYAPDAEAYTLFSPLFDPIIEDYHVGFKQTDKHPNKDFGDVNTFVNVDPEGKYVISTRVRCGRSMEGYPFNPCLTEAQYKEMEAKVSSTLSSLEGELKGTYYPLTGMSKEVQQKLIDDHFLFKEGDRFLQAANACRYWPAGRGIYHNDNKTFLVWVNEEDHLRIISMQMGGDLGQVFRRLTSAVNEIEKRIPFSHHDRLGFLTFCPTNLGTTVRASVHIKLPKLAANREKLEEVAGKYNLQVRGTRGEHTEAEGGIYDISNKRRMGLTEFQAVKEMQDGILELIKMEKEMHHHHHH |
| Endotoxin: | < 1 EU/μg by LAL |
| Purity: | > 90% by SDS-PAGE |
| StoRAge: | Store it under sterile conditions at -20 to -80 centigRAde. It is recommended that the protein be aliquoted for optimal stoRAge. Avoid repeated freeze-thaw cycles. |
| ConcentRAtion: | 1.0 mg/mL |
| Official Symbol: | Pen m 2 |
|
Figure Title 1: SDS-PAGE and WB
Figure Note 1: Reducing 12% SDS-PAGE (CBB stained) and WB (Anti-His Mouse Monoclonal Antibody) analysis profiles of purified Pen m 2. 1. Pen m 2 2. BSA |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| RA-3920F | Recombinant Pen ch 35 | Inquiry |
| RA-3192A | Recombinant Pen a 1 | Inquiry |
| RA-3193A | Recombinant Pen i 1 | Inquiry |
| RA-3914F | Recombinant Pen b 26 | Inquiry |
| RA-3915F | Recombinant Pen ch 13 Protein, N-His tagged | Inquiry |
| RA-3194A | Recombinant Pen m 1 | Inquiry |
| RA-3199A | Recombinant Pen m 8 | Inquiry |
| RA-3913F | Recombinant Pen b 13 | Inquiry |
| RA-3919F | Recombinant Pen ch 33 | Inquiry |
| RA-3923F | Recombinant Pen c 19 | Inquiry |
| RA-3197A | Recombinant Pen m 4 | Inquiry |
| RA-3196A | Recombinant Pen m 3 | Inquiry |
| RA-3917F | Recombinant Pen ch 20 | Inquiry |
| RA-3918F | Recombinant Pen ch 31 | Inquiry |
| RA-3198A | Recombinant Pen m 6 Protein, C-His tagged | Inquiry |
| RA-3922F | Recombinant Pen c 13 | Inquiry |
| RA-3924F | Recombinant Pen c 22 | Inquiry |
| RA-3200A | Recombinant Pen m 13 Protein, C-His tagged | Inquiry |
| RA-3916F | Recombinant Pen ch 18 Protein, N-His tagged | Inquiry |
| RA-3921F | Recombinant Pen c 3 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools