Cat.No. | ra-3198A |
Availability | |
Size | 1mg |
Price | $ |
Qty |
Description: | Recombinant Pen m 6 was expressed in E.coli with C-His tag. |
Source: | E.coli |
Species: | Penaeus monodon (Black tiger shrimp) |
MW: | 17 kDa |
Tag: | His |
Formulation: | Sterile 50mM Tris, 300mM NaCl, pH 7.5 |
Purity: | >90% by SDS-PAGE |
Storage: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration: | 0.5-1.0mg/mL |
Sequence: | MDSLDEEQIETLRKAFNSFDTEGAGSINAETVGVILRMMGVKISEKNLQEVIAETDEDGSGMLEFEEFAELAAKFLIEEDEEALKAELREAFRIYDKDCQGYITTDILKEILVELDPKLTPTDLEGIIEEVDEDGSGTLDFDEFMEMMSGHHHHHH |
GenBank Protein: | ADV17344 |
UniProt: | E7CGC5 |
Catalog# | Product Name | Inquiry |
---|---|---|
ra-3920F | Recombinant Pen ch 35 | Inquiry |
ra-3196A | Recombinant Pen m 3 | Inquiry |
ra-3195A | Recombinant Pen m 2 | Inquiry |
ra-3194A | Recombinant Pen m 1 | Inquiry |
ra-3193A | Recombinant Pen i 1 | Inquiry |
ra-3192A | Recombinant Pen a 1 | Inquiry |
ra-3197A | Recombinant Pen m 4 | Inquiry |
ra-3199A | Recombinant Pen m 8 | Inquiry |
ra-3919F | Recombinant Pen ch 33 | Inquiry |
ra-3923F | Recombinant Pen c 19 | Inquiry |
ra-3916FB | Recombinant Pen ch 18, Biotin Labeled | Inquiry |
ra-3914F | Recombinant Pen b 26 | Inquiry |
ra-3200A | Recombinant Pen m 13 | Inquiry |
ra-3916F | Recombinant Pen ch 18 | Inquiry |
ra-3918F | Recombinant Pen ch 31 | Inquiry |
ra-3913F | Recombinant Pen b 13 | Inquiry |
ra-3922F | Recombinant Pen c 13 | Inquiry |
ra-3924F | Recombinant Pen c 22 | Inquiry |
ra-3915F | Recombinant Pen ch 13 | Inquiry |
ra-3917F | Recombinant Pen ch 20 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools