Recombinant Act d 1 Protein, C-His tagged

Source:	E.coli
ShortName:	Act d 1, C-His tagged
similar:	Act d 1
Tag:	C-His
Protein length:	26-380 aa
Product Overview:	Recombinant Act d 1 Protein with C-His tag was expressed in E.coli.
Form:	Sterile 50mM Tris-HCl, pH7.5, 300mM NaCl, 0.1% SKL
Molecular Mass:	41 kDa
AASequence:	MNAKNLTQRTNDEVKAMYESWLIKYGKSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFRSTYLGFTSGSNKTKVSNQYEPRVGQVLPSYVDWRSAGAVVDIKSQGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNVGYITDGFQFIINNGGINTEENYPYTAQDGECNVDLQNEKYVTIDTYENVPYNNEWALQTAVTYQPVSVALDAAGDAFKHYSSGIFIGPCGTAIDHAVTIVGYGTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSYPVKYNNQNHPKSYSSLINPPAFSMSNDGPVGVDDGQRYSAHHHHHHHH
Purity:	> 90% by SDS-PAGE
Storage:	Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration:	0.72 mg/mL by BCA
Official Symbol:	Act d 1
	Figure Title 1: SDS-PAGE and WB Figure Note 1: Reducing 4%-20% SDS-PAGE (CBB stained) and WB (Anti-His Mouse Monoclonal antibody) analysis profiles of purified Act d 1 1. Act d 1: 1 μg 2. BSA: 1 μg

Catalog#	Product Name	Inquiry
ra-3519P	Recombinant Act d 8	Inquiry
ra-3514P	Recombinant Act d 3	Inquiry
ra-3513P	Recombinant Act d 2	Inquiry
ra-3511P	Recombinant Act c 10	Inquiry
ra-3510P	Recombinant Act c 8	Inquiry
ra-3509P	Recombinant Act c 5	Inquiry
ra-3508P	Recombinant Act c 1	Inquiry
ra-3518P	Recombinant Act d 7	Inquiry
ra-3521P	Recombinant Act d 10	Inquiry
ra-3523P	Recombinant Act d 12	Inquiry
ra-3519PB	Recombinant Act d 8, Biotin Labeled	Inquiry
ra-3520P	Recombinant Act d 9	Inquiry
ra-3515P	Recombinant Act d 4	Inquiry
ra-3516P	Recombinant Act d 5	Inquiry
ra-3522P	Recombinant Act d 11	Inquiry
ra-3524P	Recombinant Act d 13	Inquiry
ra-3517P	Recombinant Act d 6	Inquiry
ra-3722PB	Recombinant Mal d 2, Biotin Labeled	Inquiry
ra-3409P	Recombinant Coc n 1	Inquiry
ra-3406P	Recombinant Ana c 2	Inquiry

Cat.No.	ra-3512P
Availability

Specification