| Cat.No. | RA-3512P |
| Availability |
| Source: | E.coli |
| ShortName: | Act d 1, C-His tagged |
| similar: | Act d 1 |
| Tag: | C-His |
| Protein length: | 26-380 aa |
| Product Overview: | Recombinant Act d 1 Protein with C-His tag was expressed in E.coli. |
| Form: | Sterile 50mM Tris-HCl, pH7.5, 300mM NaCl, 0.1% SKL |
| Molecular Mass: | 41 kDa |
| AASequence: | MNAKNLTQRTNDEVKAMYESWLIKYGKSYNSLGEWERRFEIFKETLRFIDEHNADTNRSYKVGLNQFADLTDEEFRSTYLGFTSGSNKTKVSNQYEPRVGQVLPSYVDWRSAGAVVDIKSQGECGGCWAFSAIATVEGINKIVTGVLISLSEQELIDCGRTQNTRGCNVGYITDGFQFIINNGGINTEENYPYTAQDGECNVDLQNEKYVTIDTYENVPYNNEWALQTAVTYQPVSVALDAAGDAFKHYSSGIFIGPCGTAIDHAVTIVGYGTEGGIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATMPSYPVKYNNQNHPKSYSSLINPPAFSMSNDGPVGVDDGQRYSAHHHHHHHH |
| Purity: | > 90% by SDS-PAGE |
| StoRAge: | Store it under sterile conditions at -20 to -80 centigRAde. It is recommended that the protein be aliquoted for optimal stoRAge. Avoid repeated freeze-thaw cycles. |
| ConcentRAtion: | 0.72 mg/mL by BCA |
| Official Symbol: | Act d 1 |
|
Figure Title 1: SDS-PAGE and WB
Figure Note 1: Reducing 4%-20% SDS-PAGE (CBB stained) and WB (Anti-His Mouse Monoclonal antibody) analysis profiles of purified Act d 1 1. Act d 1: 1 μg 2. BSA: 1 μg |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| RA-3519P | Recombinant Act d 8 | Inquiry |
| RA-3514P | Recombinant Act d 3 | Inquiry |
| RA-3513P | Recombinant Act d 2 | Inquiry |
| RA-3511P | Recombinant Act c 10 | Inquiry |
| RA-3510P | Recombinant Act c 8 | Inquiry |
| RA-3509P | Recombinant Act c 5 | Inquiry |
| RA-3508P | Recombinant Act c 1 | Inquiry |
| RA-3518P | Recombinant Act d 7 | Inquiry |
| RA-3521P | Recombinant Act d 10 | Inquiry |
| RA-3523P | Recombinant Act d 12 | Inquiry |
| RA-3519PB | Recombinant Act d 8, Biotin Labeled | Inquiry |
| RA-3520P | Recombinant Act d 9 | Inquiry |
| RA-3515P | Recombinant Act d 4 | Inquiry |
| RA-3516P | Recombinant Act d 5 | Inquiry |
| RA-3522P | Recombinant Act d 11 | Inquiry |
| RA-3524P | Recombinant Act d 13 | Inquiry |
| RA-3517P | Recombinant Act d 6 | Inquiry |
| RA-3722PB | Recombinant Mal d 2, Biotin Labeled | Inquiry |
| RA-3409P | Recombinant Coc n 1 | Inquiry |
| RA-3406P | Recombinant Ana c 2 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools