Recombinant Asp f 6

Protein Name:	Asp f 6
Source:	E.coli
Species:	Common mold
MW:	26.5 kDa
Tag:	His
Formulation:	Liquid in 50 mM Hepes，300 mM NaCl，pH7.0
Purity:	>90% by SDS-PAGE
Storage:	Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration:	0.96mg/mL
GenBank Protein:	AAB60779
UniProt:	Q92450
Sequence:	MGSSHHHHHHSSGLVPRGSHMSQQYTLPPLPYPYDALQPYISQQIMELHHKKHHQTYVNGLNAALEAQKKAAEANDVPKLVSVQQAIKFNGGGHINHSLFWKNLAPEKSGGGKIDQAPVLKAAIEQRWGSFDKFKDAFNTTLLGIQGSGWGWLVTDGPKGKLDITTTHDQDPVTGAAPVFGVDMWEHAYYLQYLNDKASYAKGIWNVINWAEAENRYIAGDKGGHPFMKL

Catalog#	Product Name	Inquiry
ra-3866FB	Recombinant Asp f 6, Biotin Labeled	Inquiry
ra-3870F	Recombinant Asp f 10	Inquiry
ra-5089F	Recombinant Asp f 28	Inquiry
ra-3878F	Recombinant Asp f 22	Inquiry
ra-3877F	Recombinant Asp f 18	Inquiry
ra-3876F	Recombinant Asp f 17	Inquiry
ra-3875F	Recombinant Asp f 16	Inquiry
ra-3874F	Recombinant Asp f 15	Inquiry
ra-3873F	Recombinant Asp f 13	Inquiry
ra-3872F	Recombinant Asp f 12	Inquiry
ra-3871F	Recombinant Asp f 11	Inquiry
ra-3408P	Recombinant Aspa o 1	Inquiry
ra-3869F	Recombinant Asp f 9	Inquiry
ra-3868F	Recombinant Asp f 8	Inquiry
ra-3867F	Recombinant Asp f 7	Inquiry
ra-3865F	Recombinant Asp f 5	Inquiry
ra-3864F	Recombinant Asp f 4	Inquiry
ra-3863F	Recombinant Asp f 3	Inquiry
ra-3862F	Recombinant Asp f 1	Inquiry
ra-3861F	Recombinant Asp f 2	Inquiry

Cat.No.	ra-3866F
Availability

Specification