| Cat.No. | ra-3866F |
| Availability |
| Protein Name: | Asp f 6 |
| Source: | E.coli |
| Species: | Common mold |
| Description: | Recombinant Asp f 6 was expressed in E.coli with N-terminal His tag. |
| MW: | 26.5 kDa |
| Tag: | His |
| Formulation: | Liquid in 50 mM Hepes,300 mM NaCl,pH7.0 |
| Purity: | >90% by SDS-PAGE |
| Storage: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration: | 0.96mg/mL |
| GenBank Protein: | AAB60779 |
| UniProt: | Q92450 |
| Sequence: | MGSSHHHHHHSSGLVPRGSHMSQQYTLPPLPYPYDALQPYISQQIMELHHKKHHQTYVNGLNAALEAQKKAAEANDVPKLVSVQQAIKFNGGGHINHSLFWKNLAPEKSGGGKIDQAPVLKAAIEQRWGSFDKFKDAFNTTLLGIQGSGWGWLVTDGPKGKLDITTTHDQDPVTGAAPVFGVDMWEHAYYLQYLNDKASYAKGIWNVINWAEAENRYIAGDKGGHPFMKL |
| SDS-PAGE(Picture): | ra-3866F, 1 |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| ra-3866FB | Recombinant Asp f 6, Biotin Labeled | Inquiry |
| ra-3870F | Recombinant Asp f 10 | Inquiry |
| ra-5089F | Recombinant Asp f 28 | Inquiry |
| ra-3878F | Recombinant Asp f 22 | Inquiry |
| ra-3877F | Recombinant Asp f 18 | Inquiry |
| ra-3876F | Recombinant Asp f 17 | Inquiry |
| ra-3875F | Recombinant Asp f 16 | Inquiry |
| ra-3874F | Recombinant Asp f 15 | Inquiry |
| ra-3873F | Recombinant Asp f 13 | Inquiry |
| ra-3872F | Recombinant Asp f 12 | Inquiry |
| ra-3871F | Recombinant Asp f 11 | Inquiry |
| ra-3408P | Recombinant Aspa o 1 | Inquiry |
| ra-3869F | Recombinant Asp f 9 | Inquiry |
| ra-3868F | Recombinant Asp f 8 | Inquiry |
| ra-3867F | Recombinant Asp f 7 | Inquiry |
| ra-3865F | Recombinant Asp f 5 | Inquiry |
| ra-3864F | Recombinant Asp f 4 | Inquiry |
| ra-3863F | Recombinant Asp f 3 | Inquiry |
| ra-3862F | Recombinant Asp f 1 | Inquiry |
| ra-3861F | Recombinant Asp f 2 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools