| Cat.No. | ra-3084A |
| Availability |
| Protein Name: | Der f 2 |
| Source: | E.coli |
| Species: | American house dust mite |
| Description: | Recombinant Der f 2 was expressed in E.coli with N-terminal His tag. |
| MW: | 16.4 kDa |
| Tag: | His |
| Formulation: | Liquid in 50mM Tris, 300mM NaCl, pH8.5 |
| Purity: | >90% by SDS-PAGE |
| Storage: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration: | 1.26mg/mL |
| GenBank Protein: | BAA01239 |
| UniProt: | Q00855 |
| Sequence: | MGSSHHHHHHSSGLVPRGSHMDQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD |
| SDS-PAGE(Picture): | ra-3084A, 1 |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| ra-3084AB | Recombinant Der f 2, Biotin Labeled | Inquiry |
| ra-3084AYB | Recombinant Der f 2, Biotin Labeled | Inquiry |
| ra-3084AY | Recombinant Der f 2 | Inquiry |
| ra-3101A | Recombinant Der f 20 | Inquiry |
| ra-3089A | Recombinant Der f 6 | Inquiry |
| ra-3087A | Recombinant Der f 5 | Inquiry |
| ra-3086A | Recombinant Der f 4 | Inquiry |
| ra-3085A | Recombinant Der f 3 | Inquiry |
| ra-3083A | Recombinant Der f 1 | Inquiry |
| ra-3091A | Recombinant Der f 7 | Inquiry |
| ra-3100A | Recombinant Der f 18 | Inquiry |
| ra-3104A | Recombinant Der f 23 | Inquiry |
| ra-3095A | Recombinant Der f 8 | Inquiry |
| ra-3093A | Recombinant Der f 11 | Inquiry |
| ra-3097A | Recombinant Der f 15 | Inquiry |
| ra-3099A | Recombinant Der f 17 | Inquiry |
| ra-3103A | Recombinant Der f 22 | Inquiry |
| ra-3105A | Recombinant Der f 24 | Inquiry |
| ra-3096A | Recombinant Der f 14 | Inquiry |
| ra-3102A | Recombinant Der f 21 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools