Cat.No. | ra-4028P |
Availability |
Protein Name: | Hum s 3 |
Source: | Yeast |
Species: | Japanese hop |
Description: | Rcombinant Hum s 3 was expressed in Pichia pastoris with C-terminal His tag. |
MW: | 13kDa |
Tag: | His |
Formulation: | Liquid in PBS Buffer |
Purity: | >90% by SDS-PAGE |
Storage: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration: | 0.5mg/mL |
UniProt: | I1SKR9 |
Sequence: | EAEAEFMDNPFENGMKACTSLYDKYYQNCVMKLPPGACIDSENYRKCLTNHIGSCDIDTCFEDVSIACRSIYPSNYAECATTHHNICGDLQGALEQKLISEEDLNSAVDHHHHHH |
![]() |
|
Length: | 1-86aa |
Catalog# | Product Name | Inquiry |
---|---|---|
ra-4028PB | Recombinant Hum s 3, Biotin Labeled | Inquiry |
ra-3696P | Recombinant Hum j 1 | Inquiry |
ra-3421P | Recombinant Dac g 2 | Inquiry |
ra-3436P | Recombinant Lol p 4 | Inquiry |
ra-3435P | Recombinant Lol p 1 | Inquiry |
ra-3745PM | Recombinant Par j 2 | Inquiry |
ra-3426P | Recombinant Hol l 5 | Inquiry |
ra-3425P | Recombinant Hol l 1 | Inquiry |
ra-3424P | Recombinant Fes p 4 | Inquiry |
ra-3423P | Recombinant Dac g 4 | Inquiry |
ra-3422P | Recombinant Dac g 5 | Inquiry |
ra-3407P | Recombinant Ant o 1 | Inquiry |
ra-3420P | Recombinant Dac g 3 | Inquiry |
ra-3419P | Recombinant Dac g 1 | Inquiry |
ra-3418P | Recombinant Cyn d 24 | Inquiry |
ra-3417P | Recombinant Cyn d 23 | Inquiry |
ra-3416P | Recombinant Cyn d 22 | Inquiry |
ra-3415P | Recombinant Cyn d 15 | Inquiry |
ra-3414P | Recombinant Cyn d 12 | Inquiry |
ra-3413P | Recombinant Cyn d 7 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools