Recombinant Hum s 3, Biotin Labeled

Protein Name:	Hum s 3
Source:	Yeast
Species:	Japanese hop
Description:	Rcombinant Hum s 3 was expressed in Pichia pastoris with C-terminal His tag.
MW:	13kDa
Tag:	His
Formulation:	Liquid in PBS Buffer
Purity:	>90% by SDS-PAGE
StoRAge:	Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal stoRAge. Avoid repeated freeze-thaw cycles.
ConcentRAtion:	0.5mg/mL
UniProt:	I1SKR9
Sequence:	EAEAEFMDNPFENGMKACTSLYDKYYQNCVMKLPPGACIDSENYRKCLTNHIGSCDIDTCFEDVSIACRSIYPSNYAECATTHHNICGDLQGALEQKLISEEDLNSAVDHHHHHH
Length:	1-86aa

Catalog#	Product Name	Inquiry
RA-4028P	Recombinant Hum s 3	Inquiry
RA-3696P	Recombinant Hum j 1	Inquiry
RA-3010A	Recombinant Aed a 11	Inquiry
RA-3018A	Recombinant Api m 3	Inquiry
RA-3017A	Recombinant Api m 2	Inquiry
RA-3123AMB	Recombinant Der p 2, Biotin Labeled	Inquiry
RA-3015A	Recombinant Api d 1	Inquiry
RA-3014A	Recombinant Api c 1	Inquiry
RA-3013A	Recombinant Ano d 2	Inquiry
RA-3012A	Recombinant Aed al 3	Inquiry
RA-3011A	Recombinant Aed al 2	Inquiry
RA-3000A	Recombinant Aca s 13 Protein, C-His tagged	Inquiry
RA-3009A	Recombinant Aed a 10	Inquiry
RA-3008A	Recombinant Aed a 8	Inquiry
RA-3007A	Recombinant Aed a 7	Inquiry
RA-3006A	Recombinant Aed a 6	Inquiry
RA-3005A	Recombinant Aed a 5	Inquiry
RA-3004A	Recombinant Aed a 4	Inquiry
RA-3003A	Recombinant Aed a 3	Inquiry
RA-3002A	Recombinant Aed a 2	Inquiry

Cat.No.	RA-4028PB
Availability

Specification