| Cat.No. | RA-3002A |
| Availability |
| Protein Name: | Aed a 2 |
| Source: | E.coli |
| Species: | Aedes aegypti (Yellow fever mosquito) |
| Description: | Recombinant Aed a 2 (18-321 aa) was expressed in E.coli with His tag. |
| MW: | 37 kDa |
| Tag: | His |
| Formulation: | Lyophilized powder |
| Purity: | >85% by SDS-PAGE |
| StoRAge: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal stoRAge. Avoid repeated freeze-thaw cycles. |
| GenBank Protein: | AAA29347 |
| UniProt: | P18153 |
| Sequence: | STGPFDPEEMLFTFTRCMEDNLEDGPNRLPMLAKWKEWINEPVDSPATQCFGKCVLVRTGLYDPVAQKFDASVIQEQFKAYPSLGEKSKVEAYANAVQQLPSTNNDCAAVFKAYDPVHKAHKDTSKNLFHGNKELTKGLYEKLGKDIRQKKQSYFEFCENKYYPAGSDKRQQLCKIRQYTVLDDALFKEHTDCVMKGIRYITKNNELDAEEVKRDFMQVNKDTKALEKVLNDCKSKEPSNAGEKSWHYYKCLVESSVKDDFKEAFDYREVRSQIYAFNLPKKQVYSKPAVQSQVMEIDGKQCPQ |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| RA-3002AYB | Recombinant Aed a 2, Biotin Labeled | Inquiry |
| RA-3002AB | Recombinant Aed a 2, Biotin Labeled | Inquiry |
| RA-3002AY | Recombinant Aed a 2 | Inquiry |
| RA-3011A | Recombinant Aed al 2 | Inquiry |
| RA-3012A | Recombinant Aed al 3 | Inquiry |
| RA-3001A | Recombinant Aed a 1 | Inquiry |
| RA-3010A | Recombinant Aed a 11 | Inquiry |
| RA-3009A | Recombinant Aed a 10 | Inquiry |
| RA-3008A | Recombinant Aed a 8 | Inquiry |
| RA-3007A | Recombinant Aed a 7 | Inquiry |
| RA-3006A | Recombinant Aed a 6 | Inquiry |
| RA-3005A | Recombinant Aed a 5 | Inquiry |
| RA-3004A | Recombinant Aed a 4 | Inquiry |
| RA-3003A | Recombinant Aed a 3 | Inquiry |
| RA-3013A | Recombinant Ano d 2 | Inquiry |
| RA-3080A | Recombinant Cul q 3 | Inquiry |
| RA-3163A | Recombinant For t 1 | Inquiry |
| RA-3164A | Recombinant For t 2 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools