We use cookies to understand how you use our site and to improve the overall user experience. This includes personalizing content and advertising. Read our Privacy Policy
Accept Cookies
Cat.No. | ra-3002AYB |
Availability | April 3, 2025 |
Protein Name: | Aed a 2 |
Source: | Yeast |
Species: | Aedes aegypti (Yellow fever mosquito) |
MW: | 37 kDa |
Tag: | His |
Formulation: | Lyophilized powder |
Purity: | >85% by SDS-PAGE |
Storage: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
GenBank Protein: | AAA29347 |
UniProt: | P18153 |
Product Discription: | Recombinant biotinylation Aed a 2 (18-321 aa) was expressed in Yeast with His tag. |
Sequence: | STGPFDPEEMLFTFTRCMEDNLEDGPNRLPMLAKWKEWINEPVDSPATQCFGKCVLVRTGLYDPVAQKFDASVIQEQFKAYPSLGEKSKVEAYANAVQQLPSTNNDCAAVFKAYDPVHKAHKDTSKNLFHGNKELTKGLYEKLGKDIRQKKQSYFEFCENKYYPAGSDKRQQLCKIRQYTVLDDALFKEHTDCVMKGIRYITKNNELDAEEVKRDFMQVNKDTKALEKVLNDCKSKEPSNAGEKSWHYYKCLVESSVKDDFKEAFDYREVRSQIYAFNLPKKQVYSKPAVQSQVMEIDGKQCPQ |
Catalog# | Product Name | Inquiry |
---|---|---|
ra-3002A | Recombinant Aed a 2 | Inquiry |
ra-3002AB | Recombinant Aed a 2, Biotin Labeled | Inquiry |
ra-3002AY | Recombinant Aed a 2 | Inquiry |
ra-3004A | Recombinant Aed a 4 | Inquiry |
ra-3005A | Recombinant Aed a 5 | Inquiry |
ra-3006A | Recombinant Aed a 6 | Inquiry |
ra-3007A | Recombinant Aed a 7 | Inquiry |
ra-3008A | Recombinant Aed a 8 | Inquiry |
ra-3009A | Recombinant Aed a 10 | Inquiry |
ra-3010A | Recombinant Aed a 11 | Inquiry |
ra-3011A | Recombinant Aed al 2 | Inquiry |
ra-3012A | Recombinant Aed al 3 | Inquiry |
ra-3003A | Recombinant Aed a 3 | Inquiry |
ra-3001A | Recombinant Aed a 1 | Inquiry |
ra-3013A | Recombinant Ano d 2 | Inquiry |
ra-3080A | Recombinant Cul q 3 | Inquiry |
ra-3163A | Recombinant For t 1 | Inquiry |
ra-3164A | Recombinant For t 2 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools