Cat.No. | ra-3721PB |
Availability |
Protein Name: | Mal d 1 |
Source: | E.coli |
Species: | Apple |
MW: | 19.7 kDa |
Tag: | His |
Formulation: | Lquid in 50mM Tris,pH 8.0,300 mM NaCl |
Purity: | >90% by SDS-PAGE |
Storage: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration: | 0.5mg/mL |
GenBank Protein: | CAA58646 |
UniProt: | P43211 |
Product Discription: | Recombinant biotinylation Mal d 1 was expressed in E.coli with N-terminal His tag. |
Sequence: | MGSSHHHHHHSSGLVPRGSHMGVFNYETEFTSVIPAPRLFKAFILDGDNLIPKIAPQAIKSTKIIEGDGGVGTIKKVTFGEGSQYGYVKQRVNGIDKDNFTYSYSMIEGDTLSDKLEKITYETKLIASPDGGSIIKTNSHYHAKGDVEIKEEHVKAGKEKASGLFKLLEAYLLAHSDAYN |
Catalog# | Product Name | Inquiry |
---|---|---|
ra-3721P | Recombinant Mal d 1 | Inquiry |
ra-3966F | Recombinant Mala s 7 | Inquiry |
ra-3722PB | Recombinant Mal d 2, Biotin Labeled | Inquiry |
ra-3724PB | Recombinant Mal d 4, Biotin Labeled | Inquiry |
ra-3723PB | Recombinant Mal d 3, Biotin Labeled | Inquiry |
ra-3972F | Recombinant Mala s 13 | Inquiry |
ra-3971F | Recombinant Mala s 12 | Inquiry |
ra-3970F | Recombinant Mala s 11 | Inquiry |
ra-3969F | Recombinant Mala s 10 | Inquiry |
ra-3968F | Recombinant Mala s 9 | Inquiry |
ra-3967F | Recombinant Mala s 8 | Inquiry |
ra-3965F | Recombinant Mala s 6 | Inquiry |
ra-3964F | Recombinant Mala s 5 | Inquiry |
ra-3963F | Recombinant Mala s 1 | Inquiry |
ra-3962F | Recombinant Mala f 4 | Inquiry |
ra-3961F | Recombinant Mala f 3 | Inquiry |
ra-3960F | Recombinant Mala f 2 | Inquiry |
ra-3724P | Recombinant Mal d 4 | Inquiry |
ra-3723P | Recombinant Mal d 3 | Inquiry |
ra-3722P | Recombinant Mal d 2 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools