Recombinant Mal d 2, Biotin Labeled

Protein Name:	Mal d 2
Source:	E.coli
Species:	Malus domestica (Apple)
MW:	25.5kDa
Tag:	His
Formulation:	50mM Tris, 0.3 M NaCl, pH 7.5
Purity:	>90% by SDS-PAGE
Storage:	Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration:	0.5-1.0mg/mL
GenBank Protein:	AAC36740
UniProt:	Q9FSG7
Product Discription:	Recombinant biotinylation Mal d 2 was expressed in E.coli with His tag.
Sequence:	MGSSHHHHHHSSGLVPRGSHMAKITFTNNCPNTVWPGTLTGDQKPQLSLTGFELASKASRSVDAPSPWSGRFWGRTRCSTDAAGKFTCETADCGSGQVACNGAGAVPPATLVEITIAANGGQDYYDVSLVDGFNLPMSVAPQGGTGECKPSSCPANVNKVCPAPLQVKAADGSVISCKSACLAFGDSKYCCTPPNNTPETCPPTEYSEIFEKQCPQAYSYAYDDKNSTFTCSGGPDYVITFCP

Catalog#	Product Name	Inquiry
ra-3722P	Recombinant Mal d 2	Inquiry
ra-3971F	Recombinant Mala s 12	Inquiry
ra-3721P	Recombinant Mal d 1	Inquiry
ra-3965F	Recombinant Mala s 6	Inquiry
ra-3966F	Recombinant Mala s 7	Inquiry
ra-3723P	Recombinant Mal d 3	Inquiry
ra-3962F	Recombinant Mala f 4	Inquiry
ra-3964F	Recombinant Mala s 5	Inquiry
ra-3970F	Recombinant Mala s 11	Inquiry
ra-3723PB	Recombinant Mal d 3, Biotin Labeled	Inquiry
ra-3960F	Recombinant Mala f 2	Inquiry
ra-3724P	Recombinant Mal d 4	Inquiry
ra-3968F	Recombinant Mala s 9	Inquiry
ra-3969F	Recombinant Mala s 10	Inquiry
ra-3961F	Recombinant Mala f 3	Inquiry
ra-3721PB	Recombinant Mal d 1, Biotin Labeled	Inquiry
ra-3724PB	Recombinant Mal d 4, Biotin Labeled	Inquiry
ra-3963F	Recombinant Mala s 1	Inquiry
ra-3967F	Recombinant Mala s 8	Inquiry
ra-3972F	Recombinant Mala s 13	Inquiry

Cat.No.	ra-3722PB
Availability

Specification