| Cat.No. | RA-3787PB |
| Availability |
| Protein Name: | Pru p 1 |
| Source: | E.coli |
| Species: | Peach |
| Description: | Recombinant biotinylation Pru p 1 was expressed in E.coli with N-terminal His tag. |
| MW: | 19.81 kDa |
| Tag: | His |
| Formulation: | Liquid in PBS Buffer |
| Purity: | >90% by SDS-PAGE |
| StoRAge: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal stoRAge. Avoid repeated freeze-thaw cycles. |
| ConcentRAtion: | 0.5mg/mL |
| GenBank Protein: | ABB78006 |
| UniProt: | Q2I6V8 |
| Sequence: | MGSSHHHHHHSSGLVPRGSHMGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFGEGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSHYHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| RA-3787P | Recombinant Pru p 1 Protein, N-His tagged | Inquiry |
| RA-3771P | Recombinant Pru ar 1 | Inquiry |
| RA-3775P | Recombinant Pru av 2 | Inquiry |
| RA-3772P | Recombinant Pru ar 3 | Inquiry |
| RA-3780P | Recombinant Pru du 3 | Inquiry |
| RA-3781P | Recombinant Pru du 4 | Inquiry |
| RA-3773P | Recombinant Pru ar 5 | Inquiry |
| RA-3777P | Recombinant Pru av 4 | Inquiry |
| RA-3779P | Recombinant Pru d 3 | Inquiry |
| RA-3785P | Recombinant Pru du 10 | Inquiry |
| RA-3789P | Recombinant Pru p 3 Protein, His tagged | Inquiry |
| RA-3786P | Recombinant Pru m 7 | Inquiry |
| RA-3774P | Recombinant Pru av 1 | Inquiry |
| RA-3783P | Recombinant Pru du 6 | Inquiry |
| RA-3784P | Recombinant Pru du 8 | Inquiry |
| RA-3776P | Recombinant Pru av 3 | Inquiry |
| RA-3788P | Recombinant Pru p 2 | Inquiry |
| RA-3790P | Recombinant Pru p 4 Protein, N-His tagged | Inquiry |
| RA-3778P | Recombinant Pru av 7 | Inquiry |
| RA-3782P | Recombinant Pru du 5 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools