| Cat.No. | ra-3787P |
| Availability |
| Source: | E.coli |
| ShortName: | Pru p 1, N-His tagged |
| similar: | Pru p 1 |
| Tag: | N-His |
| Protein length: | 1-160 aa |
| Product Overview: | Recombinant Pru p 1 Protein with N-His tag was expressed in E.coli. |
| Form: | Sterile PBS, pH 7.4 |
| Molecular Mass: | 20 kDa |
| AASequence: | MGSSHHHHHHSSGLVPRGSHMGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFGEGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSHYHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN |
| Purity: | > 90% by SDS-PAGE |
| Storage: | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration: | 2.1 mg/mL by BCA |
| Official Symbol: | Pru p 1 |
|
Figure Title 1: SDS-PAGE and WB
Figure Note 1: Reducing 4%-20% SDS-PAGE (CBB stained) and WB (Anti-His Mouse Monoclonal antibody) analysis profiles of purified Pru p 1 1. Pru p 1: 1 μg 2. BSA: 1 μg |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| ra-3787PB | Recombinant Pru p 1, Biotin Labeled | Inquiry |
| ra-3786P | Recombinant Pru m 7 | Inquiry |
| ra-3771P | Recombinant Pru ar 1 | Inquiry |
| ra-3772P | Recombinant Pru ar 3 | Inquiry |
| ra-3780P | Recombinant Pru du 3 | Inquiry |
| ra-3781P | Recombinant Pru du 4 | Inquiry |
| ra-3773P | Recombinant Pru ar 5 | Inquiry |
| ra-3777P | Recombinant Pru av 4 | Inquiry |
| ra-3779P | Recombinant Pru d 3 | Inquiry |
| ra-3785P | Recombinant Pru du 10 | Inquiry |
| ra-3790P | Recombinant Pru p 4 Protein, N-His tagged | Inquiry |
| ra-3775P | Recombinant Pru av 2 | Inquiry |
| ra-3774P | Recombinant Pru av 1 | Inquiry |
| ra-3784P | Recombinant Pru du 8 | Inquiry |
| ra-3776P | Recombinant Pru av 3 | Inquiry |
| ra-3789P | Recombinant Pru p 3 Protein, His tagged | Inquiry |
| ra-3791P | Recombinant Pru p 7 | Inquiry |
| ra-3778P | Recombinant Pru av 7 | Inquiry |
| ra-3782P | Recombinant Pru du 5 | Inquiry |
| ra-3788P | Recombinant Pru p 2 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools