Cat.No. | ra-3787P |
Availability |
Protein Name: | Pru p 1 |
Product Description: | Recombinant Pru p 1 was expressed in E.coli with N-terminal His tag. |
Source: | E.coli |
Species: | Peach |
MW: | 19.81 kDa |
Tag: | His |
Formulation: | Liquid in PBS Buffer |
Purity: | >90% by SDS-PAGE |
Storage: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration: | 0.5mg/mL |
GenBank Protein: | ABB78006 |
UniProt: | Q2I6V8 |
Sequence: | MGSSHHHHHHSSGLVPRGSHMGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFGEGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSHYHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN |
![]() |
Catalog# | Product Name | Inquiry |
---|---|---|
ra-3787PB | Recombinant Pru p 1, Biotin Labeled | Inquiry |
ra-3786P | Recombinant Pru m 7 | Inquiry |
ra-3771P | Recombinant Pru ar 1 | Inquiry |
ra-3772P | Recombinant Pru ar 3 | Inquiry |
ra-3780P | Recombinant Pru du 3 | Inquiry |
ra-3781P | Recombinant Pru du 4 | Inquiry |
ra-3773P | Recombinant Pru ar 5 | Inquiry |
ra-3777P | Recombinant Pru av 4 | Inquiry |
ra-3779P | Recombinant Pru d 3 | Inquiry |
ra-3785P | Recombinant Pru du 10 | Inquiry |
ra-3790P | Recombinant Pru p 4 | Inquiry |
ra-3775P | Recombinant Pru av 2 | Inquiry |
ra-3774P | Recombinant Pru av 1 | Inquiry |
ra-3784P | Recombinant Pru du 8 | Inquiry |
ra-3776P | Recombinant Pru av 3 | Inquiry |
ra-3789P | Recombinant Pru p 3 | Inquiry |
ra-3791P | Recombinant Pru p 7 | Inquiry |
ra-3778P | Recombinant Pru av 7 | Inquiry |
ra-3782P | Recombinant Pru du 5 | Inquiry |
ra-3788P | Recombinant Pru p 2 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools