Filter By
Clear all Filters
Allergen Source
Allergen Species
Route of Allergen Exposure
Featured Products
Recombinant Pru p 1
| Cat.No. |
ra-3787P |
| Availability |
|
Inquiry
Bulk Order
Online Order
Specification
Related Products
| Protein Name: |
Pru p 1 |
| Source: |
E.coli |
| Species: |
Peach |
| MW: |
19.81 kDa |
| Tag: |
His |
| Formulation: |
Liquid in PBS Buffer |
| Purity: |
>90% by SDS-PAGE |
| Storage: |
Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration: |
0.5mg/mL |
| GenBank Protein: |
ABB78006 |
| UniProt: |
Q2I6V8 |
| Sequence: |
MGSSHHHHHHSSGLVPRGSHMGVFTYESEFTSEIPPPRLFKAFVLDADNLVPKIAPQAIKHSEILEGDGGPGTIKKITFGEGSQYGYVKHKIDSIDKENHSYSYTLIEGDALGDNLEKISYETKLVASPSGGSIIKSTSHYHTKGDVEIKEEHVKAGKEKASNLFKLIETYLKGHPDAYN |
|
 |
For research or industrial raw materials, not for personal medical use!
