| Cat.No. | ra-3296AB |
| Availability |
| Protein Name: | Ves v 5 |
| Source: | E.coli |
| Species: | Yellow jacket |
| Description: | Recombinant biotinylation Ves v 5 was expressed in E.coli with N-terminal His tag. |
| MW: | 24.9 kDa |
| Tag: | His |
| Formulation: | Liquid in PBS Buffer, pH 7.4 |
| Purity: | >90% by SDS-PAGE |
| Storage: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration: | 1.34mg/mL |
| GenBank Protein: | AAA30333 |
| UniProt: | Q05110 |
| Sequence: | MGSSHHHHHHSSGLVPRGSHMNNYCKIKCRSGIHTLCKFGISTKPNCGKNVVKGSGLTKAEKLEILKQHNEFRQKVARGLETRGKPGPQPPAKSMNTLVWNDELAQIAQVWASQCKYGHDDCRNTAKHSVGQNIAQQSTTAASFGSVSNMVQMWADEVKNYQYGSTKNKLIEVGHYTQMVWAKTKEIGCGSIKYIENGWHRHYLVCNYGPAGNIGNEPIYEKK |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| ra-3296A | Recombinant Ves v 5 | Inquiry |
| ra-3291A | Recombinant Ves s 5 | Inquiry |
| ra-3276A | Recombinant Vesp c 1 | Inquiry |
| ra-3277A | Recombinant Vesp c 5 | Inquiry |
| ra-3285A | Recombinant Ves g 5 | Inquiry |
| ra-3286A | Recombinant Ves m 1 | Inquiry |
| ra-3278A | Recombinant Vesp ma 2 | Inquiry |
| ra-3282A | Recombinant Vesp v 1 | Inquiry |
| ra-3284A | Recombinant Ves f 5 | Inquiry |
| ra-3290A | Recombinant Ves s 1 | Inquiry |
| ra-3294A | Recombinant Ves v 2 | Inquiry |
| ra-3280A | Recombinant Vesp m 1 | Inquiry |
| ra-3279A | Recombinant Vesp ma 5 | Inquiry |
| ra-3293AB | Recombinant Ves v 1, Biotin Labeled | Inquiry |
| ra-3289A | Recombinant Ves p 5 | Inquiry |
| ra-3281A | Recombinant Vesp m 5 | Inquiry |
| ra-3293A | Recombinant Ves v 1 | Inquiry |
| ra-3295A | Recombinant Ves v 3 | Inquiry |
| ra-3283A | Recombinant Vesp v 5 | Inquiry |
| ra-3287A | Recombinant Ves m 2 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools