Recombinant Ves v 5

Protein Name:	Ves v 5
Source:	E.coli
Species:	Yellow jacket
MW:	24.9 kDa
Tag:	His
Formulation:	Liquid in PBS Buffer, pH 7.4
Purity:	>90% by SDS-PAGE
Storage:	Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration:	1.34mg/mL
GenBank Protein:	AAA30333
UniProt:	Q05110
Sequence:	MGSSHHHHHHSSGLVPRGSHMNNYCKIKCRSGIHTLCKFGISTKPNCGKNVVKGSGLTKAEKLEILKQHNEFRQKVARGLETRGKPGPQPPAKSMNTLVWNDELAQIAQVWASQCKYGHDDCRNTAKHSVGQNIAQQSTTAASFGSVSNMVQMWADEVKNYQYGSTKNKLIEVGHYTQMVWAKTKEIGCGSIKYIENGWHRHYLVCNYGPAGNIGNEPIYEKK

Catalog#	Product Name	Inquiry
ra-3296AB	Recombinant Ves v 5, Biotin Labeled	Inquiry
ra-3291A	Recombinant Ves s 5	Inquiry
ra-3276A	Recombinant Vesp c 1	Inquiry
ra-3277A	Recombinant Vesp c 5	Inquiry
ra-3285A	Recombinant Ves g 5	Inquiry
ra-3286A	Recombinant Ves m 1	Inquiry
ra-3278A	Recombinant Vesp ma 2	Inquiry
ra-3282A	Recombinant Vesp v 1	Inquiry
ra-3284A	Recombinant Ves f 5	Inquiry
ra-3290A	Recombinant Ves s 1	Inquiry
ra-3294A	Recombinant Ves v 2	Inquiry
ra-3280A	Recombinant Vesp m 1	Inquiry
ra-3279A	Recombinant Vesp ma 5	Inquiry
ra-3293AB	Recombinant Ves v 1, Biotin Labeled	Inquiry
ra-3289A	Recombinant Ves p 5	Inquiry
ra-3281A	Recombinant Vesp m 5	Inquiry
ra-3293A	Recombinant Ves v 1	Inquiry
ra-3295A	Recombinant Ves v 3	Inquiry
ra-3283A	Recombinant Vesp v 5	Inquiry
ra-3287A	Recombinant Ves m 2	Inquiry

Cat.No.	ra-3296A
Availability

Specification