| Cat.No. | RA-3848FB |
| Availability |
| Protein Name: | Alt a 1 |
| Source: | E.coli |
| Species: | Alternaria plant rot fungus |
| Description: | Recombinant biotinylation Alt a 1 was expressed in E.coli with N-terminal his tag. |
| MW: | 16kDa |
| Tag: | His |
| Formulation: | Liquid in PBS Buffer |
| Purity: | >90% by SDS-PAGE |
| StoRAge: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal stoRAge. Avoid repeated freeze-thaw cycles. |
| ConcentRAtion: | 0.6mg/mL |
| UniProt: | P79085 |
| Sequence: | MGSSHHHHHHSSGLVPRGSHMDTASCPVTTEGDYVWKISEFYGRKPEGTYYNSLGFNIKATNGGTLDFTCSAQADKLEDHKWYSCGENSFMDFSFDSDRSGLLLKQKVSDDITYVATATLPNYCRAGGNGPKDFVCQGVADAYITLVTLPKSS |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| RA-3848F | Recombinant Alt a 1 Protein, N-His tagged | Inquiry |
| RA-3856F | Recombinant Alt a 12 | Inquiry |
| RA-3858FB | Recombinant Alt a 14, Biotin Labeled | Inquiry |
| RA-3849FB | Recombinant Alt a 3, Biotin Labeled | Inquiry |
| na-3366F | Aspergillus fumigatus Medium Extract | Inquiry |
| na-3848FM | Alternaria alternata Medium (Alt a 1) Extract | Inquiry |
| na-3848F | Alternaria alternata Mycelium and Spores | Inquiry |
| RA-3859F | Recombinant Alt a 15 | Inquiry |
| RA-3858F | Recombinant Alt a 14 | Inquiry |
| RA-3857F | Recombinant Alt a 13 | Inquiry |
| RA-3855F | Recombinant Alt a 10 | Inquiry |
| RA-3854F | Recombinant Alt a 8 | Inquiry |
| RA-3853F | Recombinant Alt a 7 | Inquiry |
| RA-3852F | Recombinant Alt a 6 | Inquiry |
| RA-3851F | Recombinant Alt a 5 | Inquiry |
| RA-3850F | Recombinant Alt a 4 | Inquiry |
| RA-3849F | Recombinant Alt a 3 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools