| Cat.No. | RA-3848F |
| Availability |
| Source: | E.coli |
| ShortName: | Alt a 1, N-His tagged |
| similar: | Alt a 1 |
| Tag: | N-His |
| Protein length: | 26-157 aa |
| Product Overview: | Recombinant Alt a 1 Protein with N-His tag was expressed in E.coli. |
| Form: | Sterile PBS, pH 7.4 |
| Molecular Mass: | 17 kDa |
| AASequence: | MGSSHHHHHHSSGLVPRGSHMDTASCPVTTEGDYVWKISEFYGRKPEGTYYNSLGFNIKATNGGTLDFTCSAQADKLEDHKWYSCGENSFMDFSFDSDRSGLLLKQKVSDDITYVATATLPNYCRAGGNGPKDFVCQGVADAYITLVTLPKSS |
| Purity: | > 90% by SDS-PAGE |
| StoRAge: | Store it under sterile conditions at -20 to -80 centigRAde. It is recommended that the protein be aliquoted for optimal stoRAge. Avoid repeated freeze-thaw cycles. |
| ConcentRAtion: | 1.25 mg/mL by BCA |
| Official Symbol: | Alt a 1 |
|
Figure Title 1: SDS-PAGE and WB
Figure Note 1: Reducing 4%-20% SDS-PAGE (CBB stained) and WB (Anti-His Mouse Monoclonal antibody) analysis profiles of purified Alt a 1 1. Alt a 1: 1 μg 2. BSA: 1 μg |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| RA-3848FB | Recombinant Alt a 1, Biotin Labeled | Inquiry |
| RA-3857F | Recombinant Alt a 13 | Inquiry |
| RA-3858FB | Recombinant Alt a 14, Biotin Labeled | Inquiry |
| RA-3849FB | Recombinant Alt a 3, Biotin Labeled | Inquiry |
| na-3366F | Aspergillus fumigatus Medium Extract | Inquiry |
| na-3848FM | Alternaria alternata Medium (Alt a 1) Extract | Inquiry |
| na-3848F | Alternaria alternata Mycelium and Spores | Inquiry |
| RA-3859F | Recombinant Alt a 15 | Inquiry |
| RA-3858F | Recombinant Alt a 14 | Inquiry |
| RA-3849F | Recombinant Alt a 3 | Inquiry |
| RA-3856F | Recombinant Alt a 12 | Inquiry |
| RA-3855F | Recombinant Alt a 10 | Inquiry |
| RA-3854F | Recombinant Alt a 8 | Inquiry |
| RA-3853F | Recombinant Alt a 7 | Inquiry |
| RA-3852F | Recombinant Alt a 6 | Inquiry |
| RA-3851F | Recombinant Alt a 5 | Inquiry |
| RA-3850F | Recombinant Alt a 4 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools