Protein Name: | Ara h 2 |
Cat#: | ra-3555PB |
Product Name: | Recombinant Ara h 2, Biotin Labeled |
Source: | E.coli |
Species: | Arachis hypogaea (Peanut, groundnut) |
MW: | 17 kDa |
Tag: | His |
Formulation: | 50 mM Tris-HCl, 300 mM NaCl (pH 7.5) |
Purity: | >90% by SDS-PAGE |
Storage: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration: | 0.5-1.0mg/mL |
UniProt: | Q6PSU2 |
Product Discription: | Recombinant biotinylation Ara h 2(22-172aa) was expressed in E.coli with His tag. |
Sequence: | RQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSYGRDPYSPSQDPYSPSQDPDRR DPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQF KRELRNLPQQCGLRAPQRCDLEVESGGRDRY |
Catalog# | Product Name | Inquiry |
---|---|---|
ra-3555P | Recombinant Ara h 2 | Inquiry |
ra-3555PP | Recombinant Ara h 2 | Inquiry |
ra-3555PPB | Recombinant Ara h 2, Biotin Labeled | Inquiry |
ra-3566P | Recombinant Ara h 13 | Inquiry |
ra-3554P | Recombinant Ara h 1 | Inquiry |
ra-3562PY | Recombinant Ara h 9 | Inquiry |
ra-3556P | Recombinant Ara h 3 | Inquiry |
ra-3571P | Recombinant Ara h 18 | Inquiry |
ra-3570P | Recombinant Ara h 17 | Inquiry |
ra-3569P | Recombinant Ara h 16 | Inquiry |
ra-3568P | Recombinant Ara h 15 | Inquiry |
ra-3567P | Recombinant Ara h 14 | Inquiry |
ra-3557P | Recombinant Ara h 4 | Inquiry |
ra-3565P | Recombinant Ara h 12 | Inquiry |
ra-3564P | Recombinant Ara h 11 | Inquiry |
ra-3563P | Recombinant Ara h 10 | Inquiry |
ra-3562P | Recombinant Ara h 9 | Inquiry |
ra-3561P | Recombinant Ara h 8 | Inquiry |
ra-3560P | Recombinant Ara h 7 | Inquiry |
ra-3559P | Recombinant Ara h 6 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools