| Cat.No. | RA-3555PB |
| Availability |
| Protein Name: | ARA h 2 |
| Source: | E.coli |
| Species: | ARAchis hypogaea (Peanut, groundnut) |
| Description: | Recombinant biotinylation ARA h 2(22-172aa) was expressed in E.coli with His tag. |
| MW: | 17 kDa |
| Tag: | His |
| Formulation: | 50 mM Tris-HCl, 300 mM NaCl (pH 7.5) |
| Purity: | >90% by SDS-PAGE |
| StoRAge: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal stoRAge. Avoid repeated freeze-thaw cycles. |
| ConcentRAtion: | 0.5-1.0mg/mL |
| UniProt: | Q6PSU2 |
| Sequence: | RQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSYGRDPYSPSQDPYSPSQDPDRR DPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQF KRELRNLPQQCGLRAPQRCDLEVESGGRDRY |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| RA-3555P | Recombinant Ara h 2 | Inquiry |
| RA-3569P | Recombinant Ara h 16 | Inquiry |
| RA-3554P | Recombinant Ara h 1 | Inquiry |
| RA-3563P | Recombinant Ara h 10 | Inquiry |
| RA-3564P | Recombinant Ara h 11 | Inquiry |
| RA-3556P | Recombinant Ara h 3 | Inquiry |
| RA-3560P | Recombinant Ara h 7 | Inquiry |
| RA-3562P | Recombinant Ara h 8 Protein, N-His tagged | Inquiry |
| RA-3568P | Recombinant Ara h 15 | Inquiry |
| RA-3559PE | Recombinant Ara h 6 | Inquiry |
| RA-3558P | Recombinant Ara h 5 | Inquiry |
| RA-3557P | Recombinant Ara h 4 | Inquiry |
| RA-3566P | Recombinant Ara h 13 | Inquiry |
| RA-3567P | Recombinant Ara h 14 | Inquiry |
| RA-3559P | Recombinant Ara h 6 | Inquiry |
| RA-3571P | Recombinant Ara h 18 | Inquiry |
| RA-3554PB | Recombinant Ara h 1, Biotin Labeled | Inquiry |
| RA-3561P | Recombinant Ara h 8 Protein, C-His tagged | Inquiry |
| RA-3565P | Recombinant Ara h 12 | Inquiry |
| RA-3570P | Recombinant Ara h 17 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools