Recombinant Ara h 8 Protein, N-His tagged

Source:	E.coli
ShortName:	ARA h 8, N-His tagged
similar:	ARA h 8
Tag:	N-His
Product Overview:	Recombinant ARA h 8 Protein with N-His tag was expressed in E.coli.
Form:	20mM Tris, 200mM NaCl, pH 8.0
Molecular Mass:	19 kDa
AASequence:	MGSSHHHHHHSSGLVPRGSHMGVFTFEDEITSTVPPAKLYNAMKDADSITPKIIDDVKSVEIVEGNGGPGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQY
Purity:	> 90% by SDS-PAGE
StoRAge:	Store it under sterile conditions at -20 to -80 centigRAde. It is recommended that the protein be aliquoted for optimal stoRAge. Avoid repeated freeze-thaw cycles.
ConcentRAtion:	5.2 mg/mL
Official Symbol:	ARA h 8
	Figure Title 1: SDS-PAGE and WB Figure Note 1: Reducing 12% SDS-PAGE and WB analysis profiles of purified ARA h 8. 1. ARA h 8 2. BSA

Catalog#	Product Name	Inquiry
RA-3562PY	Recombinant Ara h 9	Inquiry
RA-3562PB	Recombinant Ara h 9, Biotin Labeled	Inquiry
RA-3559PE	Recombinant Ara h 6	Inquiry
RA-3555PB	Recombinant Ara h 2, Biotin Labeled	Inquiry
RA-3570P	Recombinant Ara h 17	Inquiry
RA-3569P	Recombinant Ara h 16	Inquiry
RA-3568P	Recombinant Ara h 15	Inquiry
RA-3567P	Recombinant Ara h 14	Inquiry
RA-3566P	Recombinant Ara h 13	Inquiry
RA-3565P	Recombinant Ara h 12	Inquiry
RA-3564P	Recombinant Ara h 11	Inquiry
RA-3563P	Recombinant Ara h 10	Inquiry
RA-3561P	Recombinant Ara h 8 Protein, C-His tagged	Inquiry
RA-3560P	Recombinant Ara h 7	Inquiry
RA-3559P	Recombinant Ara h 6	Inquiry
RA-3558P	Recombinant Ara h 5	Inquiry
RA-3557P	Recombinant Ara h 4	Inquiry
RA-3556P	Recombinant Ara h 3	Inquiry
RA-3555P	Recombinant Ara h 2	Inquiry
RA-3554P	Recombinant Ara h 1	Inquiry

Cat.No.	RA-3562P
Availability

Specification