| Cat.No. | ra-3561P |
| Availability | |
| Size | 1mg |
| Price | $ |
| Qty |
| Source: | E.coli |
| ShortName: | Ara h 8, C-His tagged |
| similar: | Ara h 8 |
| Tag: | C-His |
| Product Overview: | Recombinant Ara h 8 Protein with C-His tag was expressed in E.coli. |
| Form: | 20mM Tris, 100mM NaCl, pH 8.0 |
| Molecular Mass: | 18 kDa |
| AASequence: | MGVFTFEDEITSTVPPAKLYNAMKDADSITPKIIDDVKSVEIVEGNGGPGTIKKLTIVEDGETKFILHKVESIDEANYAYNYSVVGGVALPPTAEKITFETKLVEGPNGGSIGKLTLKYHTKGDAKPDEEELKKGKAKGEGLFRAIEGYVLANPTQYLEHHHHHH |
| Purity: | > 90% by SDS-PAGE |
| Storage: | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration: | 1.1 mg/mL |
| Official Symbol: | Ara h 8 |
|
Figure Title 1: SDS-PAGE and WB
Figure Note 1: Reducing 12% SDS-PAGE and WB analysis profiles of purified Ara h 8. 1. Ara h 8 2. BSA |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| ra-3563P | Recombinant Ara h 10 | Inquiry |
| ra-3559PE | Recombinant Ara h 6 | Inquiry |
| ra-3555PB | Recombinant Ara h 2, Biotin Labeled | Inquiry |
| ra-3571P | Recombinant Ara h 18 | Inquiry |
| ra-3570P | Recombinant Ara h 17 | Inquiry |
| ra-3569P | Recombinant Ara h 16 | Inquiry |
| ra-3568P | Recombinant Ara h 15 | Inquiry |
| ra-3567P | Recombinant Ara h 14 | Inquiry |
| ra-3566P | Recombinant Ara h 13 | Inquiry |
| ra-3565P | Recombinant Ara h 12 | Inquiry |
| ra-3564P | Recombinant Ara h 11 | Inquiry |
| ra-3562P | Recombinant Ara h 8 Protein, N-His tagged | Inquiry |
| ra-3560P | Recombinant Ara h 7 | Inquiry |
| ra-3559P | Recombinant Ara h 6 | Inquiry |
| ra-3558P | Recombinant Ara h 5 | Inquiry |
| ra-3557P | Recombinant Ara h 4 | Inquiry |
| ra-3556P | Recombinant Ara h 3 | Inquiry |
| ra-3555P | Recombinant Ara h 2 | Inquiry |
| ra-3554P | Recombinant Ara h 1 | Inquiry |
| ra-3554PB | Recombinant Ara h 1, Biotin Labeled | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools