Recombinant Che a 1, Biotin Labeled

Protein Name:	Che a 1
Source:	Yeast
Species:	Chenopodium album
Description:	Recombinant biotinylation Che a 1 was expressed in Pichia pastoris with His tag.
MW:	25kDa
Tag:	His
Formulation:	Liquid in PBS Buffer
Purity:	>90% by SDS-PAGE
StoRAge:	Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal stoRAge. Avoid repeated freeze-thaw cycles.
ConcentRAtion:	0.6mg/mL
GenBank Protein:	AAL07319
UniProt:	Q8LGR0
Sequence:	AENHFKVQGMVYCDTCRIQFMTRISTIMEGATVKLECRNITAGTQTFKAEAVTDKVGQYSIPVNGDFEDDICEIELVKSPNSECSEVSHDVYAKQSAKVSLTSNNGEASDIRSANALGFMRKEPLKECPEVLKELDLYDVKAN
Length:	26-168aa

Catalog#	Product Name	Inquiry
RA-3625P	Recombinant Che a 1	Inquiry
RA-3626P	Recombinant Che a 2	Inquiry
RA-3627P	Recombinant Che a 3	Inquiry
RA-3010A	Recombinant Aed a 11	Inquiry
RA-3018A	Recombinant Api m 3	Inquiry
RA-3017A	Recombinant Api m 2	Inquiry
RA-3015A	Recombinant Api d 1	Inquiry
RA-3014A	Recombinant Api c 1	Inquiry
RA-3013A	Recombinant Ano d 2	Inquiry
RA-3012A	Recombinant Aed al 3	Inquiry
RA-3011A	Recombinant Aed al 2	Inquiry
RA-3000A	Recombinant Aca s 13 Protein, C-His tagged	Inquiry
RA-3123AMB	Recombinant Der p 2, Biotin Labeled	Inquiry
RA-3008A	Recombinant Aed a 8	Inquiry
RA-3007A	Recombinant Aed a 7	Inquiry
RA-3006A	Recombinant Aed a 6	Inquiry
RA-3005A	Recombinant Aed a 5	Inquiry
RA-3004A	Recombinant Aed a 4	Inquiry
RA-3003A	Recombinant Aed a 3	Inquiry
RA-3002A	Recombinant Aed a 2	Inquiry

Cat.No.	RA-3625PB
Availability

Specification