| Cat.No. | ra-3900FB |
| Availability |
| Protein Name: | Cla h 8 |
| Source: | E.coli |
| Species: | Cladosporium herbarum (Fungus of plants) |
| Description: | Recombinant biotinylation Cla h 8 was expressed in E.coli with His tag. |
| MW: | 30.6 kDa |
| Tag: | His |
| Formulation: | 50mM Tris, 300mM NaCl, pH 8.0 |
| Purity: | >90% by SDS-PAGE |
| Storage: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration: | 0.5-1.0mg/mL |
| GenBank Protein: | AAO91801 |
| UniProt: | P0C0Y5 |
| Sequence: | MGSSHHHHHHSSGLVPRGSHMPGQQATKHESLLDQLSLKGKVVVVTGASGPKGMGIEAARGCAEMGAAVAITYASRAQGAEENVKELEKTYGIKAKAYKCQVDSYESCEKLVKDVVADFGQIDAFIANAGATADSGILDGSVEAWNHVVQVDLNGTFHCAKAVGHHFKERGTGSLVITASMSGHIANFPQEQTSYNVAKAGCIHMARSLANEWRDFARVNSISPGYIDTGLSDFVPKETQQLWHSMIPMGRDGLAKELKGAYVYFASDASTYTTGADLLIDGGYTTR |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| ra-3900F | Recombinant Cla h 8 Protein, N-His tagged | Inquiry |
| ra-3894F | Recombinant Cla c 9 | Inquiry |
| ra-3895F | Recombinant Cla c 14 | Inquiry |
| ra-3896F | Recombinant Cla h 2 | Inquiry |
| ra-3897F | Recombinant Cla h 5 | Inquiry |
| ra-3898F | Recombinant Cla h 6 | Inquiry |
| ra-3899F | Recombinant Cla h 7 | Inquiry |
| ra-3901F | Recombinant Cla h 10 | Inquiry |
| ra-3902F | Recombinant Cla h 9 | Inquiry |
| ra-3903F | Recombinant Cla h 12 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools