Filter By
Clear all Filters
Allergen Source
Allergen Species
Route of Allergen Exposure
Featured Products
Recombinant Cla h 8, Biotin Labeled
| Cat.No. |
ra-3900FB |
| Availability |
|
Inquiry
Bulk Order
Online Order
Specification
Related Products
| Protein Name: |
Cla h 8 |
| Source: |
E.coli |
| Species: |
Cladosporium herbarum (Fungus of plants) |
| MW: |
30.6 kDa |
| Tag: |
His |
| Formulation: |
50mM Tris, 300mM NaCl, pH 8.0 |
| Purity: |
>90% by SDS-PAGE |
| Storage: |
Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration: |
0.5-1.0mg/mL |
| GenBank Protein: |
AAO91801 |
| UniProt: |
P0C0Y5 |
| Product Discription: |
Recombinant biotinylation Cla h 8 was expressed in E.coli with His tag. |
| Sequence: |
MGSSHHHHHHSSGLVPRGSHMPGQQATKHESLLDQLSLKGKVVVVTGASGPKGMGIEAARGCAEMGAAVAITYASRAQGAEENVKELEKTYGIKAKAYKCQVDSYESCEKLVKDVVADFGQIDAFIANAGATADSGILDGSVEAWNHVVQVDLNGTFHCAKAVGHHFKERGTGSLVITASMSGHIANFPQEQTSYNVAKAGCIHMARSLANEWRDFARVNSISPGYIDTGLSDFVPKETQQLWHSMIPMGRDGLAKELKGAYVYFASDASTYTTGADLLIDGGYTTR |
For research or industrial raw materials, not for personal medical use!
