Cat.No. | ra-4001P |
Availability |
Description: | Recombinant Cup a 1 was expressed in E.coli with His/Myc tag. |
Source: | E.coli |
Species: | Cupressus arizonica (Cypress) |
MW: | 40 kDa |
Tag: | His/Myc |
Formulation: | Sterile PBS, pH 7.4 |
Purity: | >90% by SDS-PAGE |
Storage: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration: | 0.5-1.0mg/mL |
Sequence: | MDNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPV NPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADVHLGNGGPC LFMRKASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWI DHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAF NQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNES YKKEVTKRIGCETTSACANWVWRSTRDAFTNGAYFVSSGKAEDTNIYNSNEAFKV ENGNAAPQLTQNAGVVAEQKLISEEDLHHHHHHHH |
GenBank Protein: | CAB62551 |
UniProt: | Q9SCG9 |
Catalog# | Product Name | Inquiry |
---|---|---|
ra-4001PB | Recombinant Cup a 1, Biotin Labeled | Inquiry |
ra-4002P | Recombinant Cup s 1 | Inquiry |
ra-4003P | Recombinant Cup s 2 | Inquiry |
ra-4004P | Recombinant Cup s 3 | Inquiry |
ra-4005P | Recombinant Cup s 7 | Inquiry |
ra-3601P | Recombinant Bet v 8 | Inquiry |
ra-3682P | Recombinant Hev b 2 | Inquiry |
ra-3681P | Recombinant Hev b 1 | Inquiry |
ra-3664P | Recombinant Fag s 1 | Inquiry |
ra-3638P | Recombinant Cof a 3 | Inquiry |
ra-3637P | Recombinant Cof a 2 | Inquiry |
ra-3636P | Recombinant Cof a 1 | Inquiry |
ra-3616P | Recombinant Car b 1 | Inquiry |
ra-3599P | Recombinant Bet v 6 | Inquiry |
ra-3598P | Recombinant Bet v 4 | Inquiry |
ra-3764P1 | Recombinant Pla a 3.02 | Inquiry |
ra-3596P | Recombinant Bet v 2 | Inquiry |
ra-3595P | Recombinant Bet v 1 | Inquiry |
ra-3527P | Recombinant Aln g 4 | Inquiry |
ra-3526P | Recombinant Aln g 1 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools