Cat.No. | ra-3595P |
Availability | |
Size | 100µg200ug1mg |
Price | $ |
Qty |
Protein Name: | Bet v 1 |
Source: | E.coli |
Species: | European white birch |
Description: | Recombinant Bet v 1 was expressed in E.coli with N-terminal His tag. |
MW: | 17 kDa |
Tag: | His |
Formulation: | Liquid in PBS Buffer |
Purity: | >90% by SDS-PAGE |
Storage: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration: | 0.5mg/mL |
GenBank Protein: | CAA33887 |
UniProt: | P15494 |
Sequence: | MGHHHHHHGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEM GETLLRAVESYLLAHSDAYN |
![]() |
Catalog# | Product Name | Inquiry |
---|---|---|
ra-3595PP | Recombinant Bet v 1 | Inquiry |
ra-3595PPB | Recombinant Bet v 1, Biotin Labeled | Inquiry |
ra-3595PB | Recombinant Bet v 1, Biotin Labeled | Inquiry |
ra-3600P | Recombinant Bet v 7 | Inquiry |
ra-3596PB | Recombinant Bet v 2, Biotin Labeled | Inquiry |
ra-3597PB | Recombinant Bet v 3, Biotin Labeled | Inquiry |
ra-3601P | Recombinant Bet v 8 | Inquiry |
ra-3598PB | Recombinant Bet v 4, Biotin Labeled | Inquiry |
ra-3599P | Recombinant Bet v 6 | Inquiry |
ra-3598P | Recombinant Bet v 4 | Inquiry |
ra-3597P | Recombinant Bet v 3 | Inquiry |
ra-3596P | Recombinant Bet v 2 | Inquiry |
ra-3594P | Recombinant Beta v 2 | Inquiry |
ra-3593P | Recombinant Beta v 1 | Inquiry |
ra-3616P | Recombinant Car b 1 | Inquiry |
ra-3636P | Recombinant Cof a 1 | Inquiry |
ra-3764P1 | Recombinant Pla a 3.02 | Inquiry |
ra-3668P | Recombinant Fra e 1 | Inquiry |
ra-3681P | Recombinant Hev b 1 | Inquiry |
ra-3527P | Recombinant Aln g 4 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools