| Cat.No. | ra-3595P |
| Availability | |
| Size | 100µg200ug1mg |
| Price | $ |
| Qty |
| Protein Name: | Bet v 1 |
| Source: | E.coli |
| Species: | European white birch |
| Description: | Recombinant Bet v 1 was expressed in E.coli with N-terminal His tag. |
| MW: | 17 kDa |
| Tag: | His |
| Formulation: | Liquid in PBS Buffer |
| Purity: | >90% by SDS-PAGE |
| Storage: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration: | 0.5mg/mL |
| GenBank Protein: | CAA33887 |
| UniProt: | P15494 |
| Sequence: | MGHHHHHHGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEM GETLLRAVESYLLAHSDAYN |
![]() |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| ra-3595PP | Recombinant Bet v 1 | Inquiry |
| ra-3595PPB | Recombinant Bet v 1, Biotin Labeled | Inquiry |
| ra-3595PB | Recombinant Bet v 1, Biotin Labeled | Inquiry |
| ra-3600P | Recombinant Bet v 7 | Inquiry |
| ra-3596PB | Recombinant Bet v 2, Biotin Labeled | Inquiry |
| ra-3597PB | Recombinant Bet v 3, Biotin Labeled | Inquiry |
| ra-3601P | Recombinant Bet v 8 | Inquiry |
| ra-3598PB | Recombinant Bet v 4, Biotin Labeled | Inquiry |
| ra-3599P | Recombinant Bet v 6 | Inquiry |
| ra-3598P | Recombinant Bet v 4 | Inquiry |
| ra-3597P | Recombinant Bet v 3 | Inquiry |
| ra-3596P | Recombinant Bet v 2 | Inquiry |
| ra-3594P | Recombinant Beta v 2 | Inquiry |
| ra-3593P | Recombinant Beta v 1 | Inquiry |
| ra-3616P | Recombinant Car b 1 | Inquiry |
| ra-3636P | Recombinant Cof a 1 | Inquiry |
| ra-3764P1 | Recombinant Pla a 3.02 | Inquiry |
| ra-3668P | Recombinant Fra e 1 | Inquiry |
| ra-3681P | Recombinant Hev b 1 | Inquiry |
| ra-3527P | Recombinant Aln g 4 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools