| Cat.No. | ra-3596PB |
| Availability |
| Source: | E.coli |
| ShortName: | Bet v 1, N-His tagged |
| similar: | Bet v 1 |
| Tag: | N-His |
| Conjugation/Label: | Biotin |
| Product Overview: | Biotin Labeled recombinant Bet v 1 Protein with N-His tag was expressed in E.coli. |
| Form: | PBS, pH 7.4 |
| Molecular Mass: | 18.45 kDa |
| AASequence: | MGHHHHHHGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN |
| Purity: | > 90% by SDS-PAGE |
| Storage: | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration: | 1 mg/mL |
| Official Symbol: | Bet v 1 |
|
Figure Title 1: SDS-PAGE and WB
Figure Note 1: |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| ra-3596P | Recombinant Bet v 2 Protein, C-His tagged | Inquiry |
| ra-3599P | Recombinant Bet v 6 | Inquiry |
| ra-3595PP | Recombinant Bet v 1 | Inquiry |
| ra-3595PB | Recombinant Bet v 1 Protein, Biotin Labeled | Inquiry |
| ra-3595PPB | Recombinant Bet v 1, Biotin Labeled | Inquiry |
| ra-3601P | Recombinant Bet v 8 | Inquiry |
| ra-3600P | Recombinant Bet v 7 | Inquiry |
| ra-3597PB | Recombinant Bet v 3, Biotin Labeled | Inquiry |
| ra-3598P | Recombinant Bet v 4 | Inquiry |
| ra-3597P | Recombinant Bet v 3 | Inquiry |
| ra-3595P | Recombinant Bet v 1 Protein, N-His tagged | Inquiry |
| ra-3594P | Recombinant Beta v 2 | Inquiry |
| ra-3593P | Recombinant Beta v 1 | Inquiry |
| ra-3598PB | Recombinant Bet v 4, Biotin Labeled | Inquiry |
| ra-3616P | Recombinant Car b 1 | Inquiry |
| ra-3636P | Recombinant Cof a 1 | Inquiry |
| ra-3764P1 | Recombinant Pla a 3.02 | Inquiry |
| ra-3527P | Recombinant Aln g 4 | Inquiry |
| ra-3664P | Recombinant Fag s 1 | Inquiry |
| ra-3668P | Recombinant Fra e 1 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools