| Cat.No. | RA-3595P |
| Availability | |
| Size | 100µg1mg |
| Price | $ |
| Qty |
| Source: | E.coli |
| ShortName: | Bet v 1, N-His tagged |
| similar: | Bet v 1 |
| Tag: | N-His |
| Product Overview: | Recombinant Bet v 1 Protein with N-His tag was expressed in E.coli. |
| Form: | Lyophilized from sterile PBS, pH7.4, 5% Trehalose, 5% mannitol. |
| Molecular Mass: | 18 kDa |
| AASequence: | MGHHHHHHGVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN |
| Purity: | > 90% by SDS-PAGE |
| StoRAge: | Store it under sterile conditions at -20 to -80 centigRAde. It is recommended that the protein be aliquoted for optimal stoRAge. Avoid repeated freeze-thaw cycles. |
| Reconstitution: | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.38 mg/mL. Centrifuge the vial at 4 centigRAde before opening to recover the entire contents. |
| Official Symbol: | Bet v 1 |
|
Figure Title 1: SDS-PAGE and WB
Figure Note 1: Reducing 4%-20% SDS-PAGE (CBB stained) and WB (Anti-His Mouse Monoclonal antibody) analysis profiles of purified Bet v 1 1. Bet v 1 2. BSA |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| RA-3595PPB | Recombinant Bet v 1, Biotin Labeled | Inquiry |
| RA-3595PB | Recombinant Bet v 1 Protein, Biotin Labeled | Inquiry |
| RA-3595PP | Recombinant Bet v 1 | Inquiry |
| RA-3593P | Recombinant Beta v 1 | Inquiry |
| RA-3601P | Recombinant Bet v 8 | Inquiry |
| RA-3594P | Recombinant Beta v 2 | Inquiry |
| RA-3599P | Recombinant Bet v 6 | Inquiry |
| RA-3597PB | Recombinant Bet v 3, Biotin Labeled | Inquiry |
| RA-3598PB | Recombinant Bet v 4, Biotin Labeled | Inquiry |
| RA-3597P | Recombinant Bet v 3 | Inquiry |
| RA-3598P | Recombinant Bet v 4 | Inquiry |
| RA-3596PB | Recombinant Bet v 1 Protein, N-His tagged, Biotin Labeled | Inquiry |
| RA-3596P | Recombinant Bet v 2 Protein, C-His tagged | Inquiry |
| RA-3600P | Recombinant Bet v 7 | Inquiry |
| RA-3010A | Recombinant Aed a 11 | Inquiry |
| RA-3123AMB | Recombinant Der p 2, Biotin Labeled | Inquiry |
| RA-3012A | Recombinant Aed al 3 | Inquiry |
| RA-3011A | Recombinant Aed al 2 | Inquiry |
| RA-3005A | Recombinant Aed a 5 | Inquiry |
| RA-3004A | Recombinant Aed a 4 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools