| Cat.No. | RA-3596P |
| Availability | |
| Size | 250μg |
| Price | $ |
| Qty |
| Source: | E.coli |
| ShortName: | Bet v 2, C-His tagged |
| similar: | Bet v 2 |
| Tag: | C-His |
| Protein length: | 1-133 aa |
| Product Overview: | Recombinant Bet v 2 Protein with C-His tag was expressed in E.coli. |
| Form: | Sterile 50mM Tris, 300mM NaCl, 20% Glycerol, pH8.0 |
| Molecular Mass: | 15 kDa |
| AASequence: | MSWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPGHLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIDQGLHHHHHH |
| Purity: | > 90% by SDS-PAGE |
| StoRAge: | Store it under sterile conditions at -20 to -80 centigRAde. It is recommended that the protein be aliquoted for optimal stoRAge. Avoid repeated freeze-thaw cycles. |
| ConcentRAtion: | 0.5 mg/mL by BCA |
| Official Symbol: | Bet v 2 |
|
Figure Title 1: SDS-PAGE and WB
Figure Note 1: Reducing 4%-20% SDS-PAGE (CBB stained) and WB (Anti-His Mouse Monoclonal antibody) analysis profiles of purified Bet v 2 1. Bet v 2: 1 μg 2. BSA: 1 μg |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| RA-3596PB | Recombinant Bet v 1 Protein, N-His tagged, Biotin Labeled | Inquiry |
| RA-3600P | Recombinant Bet v 7 | Inquiry |
| RA-3595PP | Recombinant Bet v 1 | Inquiry |
| RA-3595PB | Recombinant Bet v 1 Protein, Biotin Labeled | Inquiry |
| RA-3597PB | Recombinant Bet v 3, Biotin Labeled | Inquiry |
| RA-3601P | Recombinant Bet v 8 | Inquiry |
| RA-3598PB | Recombinant Bet v 4, Biotin Labeled | Inquiry |
| RA-3599P | Recombinant Bet v 6 | Inquiry |
| RA-3598P | Recombinant Bet v 4 | Inquiry |
| RA-3597P | Recombinant Bet v 3 | Inquiry |
| RA-3595P | Recombinant Bet v 1 Protein, N-His tagged | Inquiry |
| RA-3594P | Recombinant Beta v 2 | Inquiry |
| RA-3593P | Recombinant Beta v 1 | Inquiry |
| RA-3595PPB | Recombinant Bet v 1, Biotin Labeled | Inquiry |
| RA-3616P | Recombinant Car b 1 | Inquiry |
| RA-3636P | Recombinant Cof a 1 | Inquiry |
| RA-3764P1 | Recombinant Pla a 3.02 | Inquiry |
| RA-3527P | Recombinant Aln g 4 | Inquiry |
| RA-3668P | Recombinant Fra e 1 | Inquiry |
| RA-3681P | Recombinant Hev b 1 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools