Recombinant Bet v 2

Protein Name:	Bet v 2
Source:	E.coli
Species:	European white birch
MW:	15 kDa
Tag:	His
Formulation:	Liquid in 50 mM Tirs, 300 mM NaCl, 1 M urea, pH 8.0
Purity:	>90% by SDS-PAGE
Storage:	Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration:	1.0mg/mL
GenBank Protein:	AAA16522
UniProt:	P25816
Sequence:	MSWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPGHLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIDQGL

Catalog#	Product Name	Inquiry
ra-3596PB	Recombinant Bet v 2, Biotin Labeled	Inquiry
ra-3600P	Recombinant Bet v 7	Inquiry
ra-3595PP	Recombinant Bet v 1	Inquiry
ra-3595PB	Recombinant Bet v 1, Biotin Labeled	Inquiry
ra-3597PB	Recombinant Bet v 3, Biotin Labeled	Inquiry
ra-3601P	Recombinant Bet v 8	Inquiry
ra-3598PB	Recombinant Bet v 4, Biotin Labeled	Inquiry
ra-3599P	Recombinant Bet v 6	Inquiry
ra-3598P	Recombinant Bet v 4	Inquiry
ra-3597P	Recombinant Bet v 3	Inquiry
ra-3595P	Recombinant Bet v 1	Inquiry
ra-3594P	Recombinant Beta v 2	Inquiry
ra-3593P	Recombinant Beta v 1	Inquiry
ra-3595PPB	Recombinant Bet v 1, Biotin Labeled	Inquiry
ra-3616P	Recombinant Car b 1	Inquiry
ra-3636P	Recombinant Cof a 1	Inquiry
ra-3764P1	Recombinant Pla a 3.02	Inquiry
ra-3527P	Recombinant Aln g 4	Inquiry
ra-3668P	Recombinant Fra e 1	Inquiry
ra-3681P	Recombinant Hev b 1	Inquiry

Specification