| Cat.No. | RA-4001P |
| Availability |
| Source: | E.coli |
| ShortName: | Cup a 1, C-His&Myc tagged |
| similar: | Cup a 1 |
| Tag: | C-His |
| Tag 2: | Myc |
| Product Overview: | Recombinant Cup a 1 Protein with C-His&Myc tag was expressed in E.coli. |
| Form: | Sterile PBS, pH 7.4 |
| Molecular Mass: | 40 kDa |
| AASequence: | MDNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADVHLGNGGPCLFMRKASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTRDAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVVAEQKLISEEDLHHHHHHHH |
| Purity: | > 80% by SDS-PAGE |
| StoRAge: | Store it under sterile conditions at -20 to -80 centigRAde. It is recommended that the protein be aliquoted for optimal stoRAge. Avoid repeated freeze-thaw cycles. |
| ConcentRAtion: | 0.28 mg/mL by BCA |
| Official Symbol: | Cup a 1 |
|
Figure Title 1: SDS-PAGE and WB
Figure Note 1: Reducing 4%-20% SDS-PAGE (CBB stained) and WB (Anti-His Mouse Monoclonal antibody) analysis profiles of purified Cup a 1 1. Cup a 1: 1 μg 2. BSA: 1 μg |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| RA-4001PB | Recombinant Cup a 1, Biotin Labeled | Inquiry |
| RA-4002P | Recombinant Cup a 1 Protein, C-His tagged | Inquiry |
| RA-4003P | Recombinant Cup s 2 | Inquiry |
| RA-4004P | Recombinant Cup s 3 | Inquiry |
| RA-4005P | Recombinant Cup s 7 | Inquiry |
| RA-3601P | Recombinant Bet v 8 | Inquiry |
| RA-3682P | Recombinant Hev b 2 | Inquiry |
| RA-3681P | Recombinant Hev b 1 | Inquiry |
| RA-3664P | Recombinant Fag s 1 | Inquiry |
| RA-3638P | Recombinant Cof a 3 | Inquiry |
| RA-3637P | Recombinant Cof a 2 | Inquiry |
| RA-3636P | Recombinant Cof a 1 | Inquiry |
| RA-3616P | Recombinant Car b 1 | Inquiry |
| RA-3599P | Recombinant Bet v 6 | Inquiry |
| RA-3598P | Recombinant Bet v 4 | Inquiry |
| RA-3764P1 | Recombinant Pla a 3.02 | Inquiry |
| RA-3596P | Recombinant Bet v 2 Protein, C-His tagged | Inquiry |
| RA-3595P | Recombinant Bet v 1 Protein, N-His tagged | Inquiry |
| RA-3527P | Recombinant Aln g 4 | Inquiry |
| RA-3526P | Recombinant Aln g 1 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools