Recombinant Cyp c 1 Protein, C-His tagged

Source:	E.coli
ShortName:	Cyp c 1, C-His tagged
similar:	Cyp c 1
Tag:	C-His
Protein length:	1-109 aa
Product Overview:	Recombinant Cyp c 1 Protein with C-His tag was expressed in E.coli.
Form:	Sterile PBS, pH 7.4
Molecular Mass:	13 kDa
AASequence:	MAFAGILNDADITAALQGCQAADSFDYKSFFAKVGLSAKTPDDIKKAFAVIDQDKSGFIEEDELKLFLQNFSAGARALTDAETKAFLKAGDSDGDGKIGVDEFAALVKAHHHHHHHH
Endotoxin:	< 1 EU/μg by LAL
Purity:	> 90% by SDS-PAGE
Storage:	Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration:	0.85 mg/mL by BCA
Official Symbol:	Cyp c 1
	Figure Title 1: SDS-PAGE and WB Figure Note 1: Reducing 4%-20% SDS-PAGE (CBB stained) and WB (Anti-His Mouse Monoclonal antibody) analysis profiles of purified Cyp c 1 1. Cyp c 1: 1 μg 2. BSA: 1 μg

Catalog#	Product Name	Inquiry
ra-3327AE1	Recombinant Cyp c 1.02	Inquiry
ra-3327AE1B	Recombinant Cyp c 1.02, Biotin Labeled	Inquiry
ra-3328A	Recombinant Cyp c 2	Inquiry
ra-3364A	Recombinant Lat c 6	Inquiry
ra-3377A	Recombinant Pan h 4	Inquiry
ra-3376A	Recombinant Pan h 3	Inquiry
ra-3344AB	Recombinant Gad c 1, Biotin Labeled	Inquiry
ra-3374A	Recombinant Pan h 1	Inquiry
ra-3370A	Recombinant Ore m 4	Inquiry
ra-3369A	Recombinant Onc m 1	Inquiry
ra-3368A	Recombinant Onc k 5	Inquiry
ra-3365A	Recombinant Lep w 1	Inquiry
ra-3028A	Recombinant Arc s 8	Inquiry
ra-3363A	Recombinant Lat c 1	Inquiry
ra-3347A	Recombinant Gad m 3	Inquiry
ra-3346A	Recombinant Gad m 2	Inquiry
ra-3345A	Recombinant Gad m 1	Inquiry
ra-3344A	Recombinant Gad c 1	Inquiry
ra-3326A	Recombinant Cten i 1	Inquiry
ra-3323A	Recombinant Clu h 1	Inquiry

Cat.No.	ra-3327A
Availability

Specification