Cat.No. | ra-3122AE |
Availability |
Protein Name: | Der p 1 |
Source: | E.coli |
Species: | Dermatophagoides pteronyssinus (European house dust mite) |
MW: | 34.5 kDa |
Tag: | His |
Formulation: | 60mM NaCl and 50mM Tris-HCl pH 8.0. |
Purity: | >95% by SDS-PAGE |
Storage: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration: | 0.5-1.0mg/mL |
GenBank Protein: | AAB60215 |
UniProt: | P08176 |
Product Discription: | Recombinant Der p 1(20-320aa) was expressed in E.coli with His tag. |
Sequence: | MSIKTFEEYKKAFNKSYATFEDEEAARKNFLESVKYVQSNGGAINHLSDLSLDEFK NRFLMSAEAFEHLKTQFDLNAETNACSINGNAPAEIDLRQMRTVTPIRMQGGCGSAWAFS GVAATESAYLAYRNQSLDLAEQELVDCASQHGCHGDTIPRGIEYIQHNGVVQESYYRYVA REQSCRRPNAQRFGISNYCQIYPPNVNKIREALAQTHSAIAVIIGIKDLDAFRHYDGRTI IQRDNGYQPNYHAVNIVGYSNAQGVDYWIVRNSWDTNWGDNGYGYFAANIDLMMIEEYPY VVILHHHHHH. |
Catalog# | Product Name | Inquiry |
---|---|---|
ra-3122AM | Recombinant Der p 1 | Inquiry |
ra-3122AB | Recombinant Der p 1, Biotin Labeled | Inquiry |
ra-3122AEB | Recombinant Der p 1, Biotin Labeled | Inquiry |
ra-3122A | Recombinant Der p 1 | Inquiry |
ra-3100A | Recombinant Der f 18 | Inquiry |
ra-3087A | Recombinant Der f 5 | Inquiry |
ra-3086A | Recombinant Der f 4 | Inquiry |
ra-3085A | Recombinant Der f 3 | Inquiry |
ra-3084A | Recombinant Der f 2 | Inquiry |
ra-3083A | Recombinant Der f 1 | Inquiry |
ra-3083AM | Recombinant Der f 1 | Inquiry |
ra-3099A | Recombinant Der f 17 | Inquiry |
ra-3103A | Recombinant Der f 22 | Inquiry |
ra-3094A | Recombinant Der f 13 | Inquiry |
ra-3092A | Recombinant Der f 10 | Inquiry |
ra-3096A | Recombinant Der f 14 | Inquiry |
ra-3098A | Recombinant Der f 16 | Inquiry |
ra-3102A | Recombinant Der f 21 | Inquiry |
ra-3104A | Recombinant Der f 23 | Inquiry |
ra-3095A | Recombinant Der f 8 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools