| Cat.No. | RA-3137A |
| Availability |
| Source: | E.coli |
| ShortName: | Der p 20, C-His tagged |
| similar: | Der p 20 |
| Tag: | C-His |
| Protein length: | 1-356 aa |
| Product Overview: | Recombinant Der p 20 Protein with C-His tag was expressed in E.coli. |
| Form: | Sterile PBS, pH 7.4 |
| Molecular Mass: | 42 kDa |
| AASequence: | MVDPATLSKLEAGFQKLQNAQDCHSLLKKYLTRDVFDQLKNKKTDMGATLLDVIQSGVENLDSGVGIYAPDAQSYKTFAALFDPIIDDYHKGFKPTDKHPKTDFGNIENFVNVDPKNEYVLSTRVRCGRSLNGYPFNPMLTEAQYKEMETKVKGQLATFEGELKGTYYPLLGMDKATQQQLIDDHFLFKEGDRFLQAANACRYWPVGRGIFHNDKKTFLMWVNEEDHLRIISMQKGGDLKEVYGRLVKAVKHIEQKIPFSRDDRLGFLTFCPTNLGTTIRASVHIKLPKLAADRKKLEEVAGRYNLQVRGTAGEHTESVGGIYDISNKRRMGLTEYQAVKEMQDGILELIKMEKSMHHHHHHHH |
| Endotoxin: | < 1 EU/μg by LAL |
| Purity: | > 90% by SDS-PAGE |
| StoRAge: | Store it under sterile conditions at -20 to -80 centigRAde. It is recommended that the protein be aliquoted for optimal stoRAge. Avoid repeated freeze-thaw cycles. |
| ConcentRAtion: | 1.8 mg/mL by BCA |
| Official Symbol: | Der p 20 |
|
Figure Title 1: SDS-PAGE and WB
Figure Note 1: Reducing 4%-20% SDS-PAGE (CBB stained) and WB (Anti-His Mouse Monoclonal antibody) analysis profiles of purified Der p 20 1. Der p 20: 1 μg 2. BSA: 1 μg |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| RA-3100A | Recombinant Der f 18 | Inquiry |
| RA-3087A | Recombinant Der f 5 | Inquiry |
| RA-3086A | Recombinant Der f 4 | Inquiry |
| RA-3085A | Recombinant Der f 3 | Inquiry |
| RA-3084A | Recombinant Der f 2 | Inquiry |
| RA-3083A | Recombinant Der f 1 | Inquiry |
| RA-3089A | Recombinant Der f 6 | Inquiry |
| RA-3091A | Recombinant Der f 7 | Inquiry |
| RA-3099A | Recombinant Der f 17 | Inquiry |
| RA-3103A | Recombinant Der f 22 | Inquiry |
| RA-3094A | Recombinant Der f 13 | Inquiry |
| RA-3092A | Recombinant Der f 10 | Inquiry |
| RA-3096A | Recombinant Der f 14 | Inquiry |
| RA-3098A | Recombinant Der f 16 | Inquiry |
| RA-3093A | Recombinant Der f 11 | Inquiry |
| RA-3102A | Recombinant Der f 21 | Inquiry |
| RA-3104A | Recombinant Der f 23 | Inquiry |
| RA-3095A | Recombinant Der f 8 | Inquiry |
| RA-3097A | Recombinant Der f 15 | Inquiry |
| RA-3101A | Recombinant Der f 20 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools