| Cat.No. | RA-3138AB |
| Availability |
| Protein Name: | Der p 21 |
| Source: | E.coli |
| Species: | European house dust mite |
| Description: | Recombinant biotinylation Der p 21 was expressed in E.coli with N-terminal his tag. |
| MW: | 16.9kDa |
| Tag: | His |
| Formulation: | Liquid in PBS Buffer |
| Purity: | >90% by SDS-PAGE |
| StoRAge: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal stoRAge. Avoid repeated freeze-thaw cycles. |
| ConcentRAtion: | 0.5mg/mL |
| GenBank Protein: | ABC73706 |
| UniProt: | Q2L7C5 |
| Sequence: | MGSSHHHHHHSSGLVPRGSHMFIVGDKKEDEWRMAFDRLMMEELETKIDQVEKGLLHLSEQYKELEKTKSKELKEQILRELTIGENFMKGALKFFEMEAKRTDLNMFERYNYEFALESIKLLIKKLDELAKKVKAVNPDEYY |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| RA-3138A | Recombinant Der p 21 | Inquiry |
| RA-3100A | Recombinant Der f 18 | Inquiry |
| RA-3087A | Recombinant Der f 5 | Inquiry |
| RA-3086A | Recombinant Der f 4 | Inquiry |
| RA-3085A | Recombinant Der f 3 | Inquiry |
| RA-3084A | Recombinant Der f 2 | Inquiry |
| RA-3083A | Recombinant Der f 1 | Inquiry |
| RA-3089A | Recombinant Der f 6 | Inquiry |
| RA-3091A | Recombinant Der f 7 | Inquiry |
| RA-3099A | Recombinant Der f 17 | Inquiry |
| RA-3103A | Recombinant Der f 22 | Inquiry |
| RA-3094A | Recombinant Der f 13 | Inquiry |
| RA-3092A | Recombinant Der f 10 | Inquiry |
| RA-3096A | Recombinant Der f 14 | Inquiry |
| RA-3098A | Recombinant Der f 16 | Inquiry |
| RA-3093A | Recombinant Der f 11 | Inquiry |
| RA-3102A | Recombinant Der f 21 | Inquiry |
| RA-3104A | Recombinant Der f 23 | Inquiry |
| RA-3095A | Recombinant Der f 8 | Inquiry |
| RA-3101A | Recombinant Der f 20 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools