Recombinant Fra a 1, Biotin Labeled

Protein Name:	Fra a 1
Source:	E.coli
Species:	Strawberry
MW:	19.8 kDa
Tag:	His
Formulation:	Liquid in 50mM Tris, 300mM NaCl，pH 8.0
Purity:	>90% by SDS-PAGE
Storage:	Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration:	0.6mg/mL
UniProt:	Q5ULZ4
Product Discription:	Recombinant biotinylation Fra a 1 was expressed in E.coli with N-terminal His tag.
Sequence:	MGSSHHHHHHSSGLVPRGSHMMGVFTYETEFTSVIPPPRLFKAFILDADNLIPKIAPQAVKCAEIIEGDGGVGTIKKITFGEGSQFGSVTHKIDGIDKDNFAYSYSLVEGDALSDKIEKISYETKLVASSDGGSVIKSTSNYHTKGDVEIKEEHVKAGKEKASHLFKLVEDYLLANPNEYC

Catalog#	Product Name	Inquiry
ra-3665P	Recombinant Fra a 1	Inquiry
ra-3666P	Recombinant Fra a 3	Inquiry
ra-3667P	Recombinant Fra a 4	Inquiry
ra-3668P	Recombinant Fra e 1	Inquiry
ra-3509P	Recombinant Act c 5	Inquiry
ra-3517P	Recombinant Act d 6	Inquiry
ra-3516P	Recombinant Act d 5	Inquiry
ra-3514P	Recombinant Act d 3	Inquiry
ra-3513P	Recombinant Act d 2	Inquiry
ra-3512P	Recombinant Act d 1	Inquiry
ra-3511P	Recombinant Act c 10	Inquiry
ra-3510P	Recombinant Act c 8	Inquiry
ra-3722PB	Recombinant Mal d 2, Biotin Labeled	Inquiry
ra-3445P	Recombinant Mus a 4	Inquiry
ra-3444P	Recombinant Mus a 6	Inquiry
ra-3443P	Recombinant Mus a 5	Inquiry
ra-3442P	Recombinant Mus a 1	Inquiry
ra-3441P	Recombinant Mus a 3	Inquiry
ra-3440P	Recombinant Mus a 2	Inquiry
ra-3409P	Recombinant Coc n 1	Inquiry

Cat.No.	ra-3665PB
Availability

Specification