| Cat.No. | ra-3665PB |
| Availability |
| Protein Name: | Fra a 1 |
| Source: | E.coli |
| Species: | Strawberry |
| Description: | Recombinant biotinylation Fra a 1 was expressed in E.coli with N-terminal His tag. |
| MW: | 19.8 kDa |
| Tag: | His |
| Formulation: | Liquid in 50mM Tris, 300mM NaCl,pH 8.0 |
| Purity: | >90% by SDS-PAGE |
| Storage: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration: | 0.6mg/mL |
| UniProt: | Q5ULZ4 |
| Sequence: | MGSSHHHHHHSSGLVPRGSHMMGVFTYETEFTSVIPPPRLFKAFILDADNLIPKIAPQAVKCAEIIEGDGGVGTIKKITFGEGSQFGSVTHKIDGIDKDNFAYSYSLVEGDALSDKIEKISYETKLVASSDGGSVIKSTSNYHTKGDVEIKEEHVKAGKEKASHLFKLVEDYLLANPNEYC |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| ra-3665P | Recombinant Fra a 1 | Inquiry |
| ra-3666P | Recombinant Fra a 3 | Inquiry |
| ra-3667P | Recombinant Fra a 4 | Inquiry |
| ra-3668P | Recombinant Fra e 1 | Inquiry |
| ra-3444P | Recombinant Mus a 6 | Inquiry |
| ra-3514P | Recombinant Act d 3 | Inquiry |
| ra-3513P | Recombinant Act d 2 | Inquiry |
| ra-3511P | Recombinant Act c 10 | Inquiry |
| ra-3510P | Recombinant Act c 8 | Inquiry |
| ra-3509P | Recombinant Act c 5 | Inquiry |
| ra-3508P | Recombinant Act c 1 | Inquiry |
| ra-3445P | Recombinant Mus a 4 | Inquiry |
| ra-3722PB | Recombinant Mal d 2, Biotin Labeled | Inquiry |
| ra-3442P | Recombinant Mus a 1 | Inquiry |
| ra-3441P | Recombinant Mus a 3 | Inquiry |
| ra-3440P | Recombinant Mus a 2 | Inquiry |
| ra-3409P | Recombinant Coc n 1 | Inquiry |
| ra-3406P | Recombinant Ana c 2 | Inquiry |
| ra-3405P | Recombinant Ana c 1 | Inquiry |
| ra-3343A | Recombinant Fel d 8 Protein, N-His tagged | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools