Cat.No. | ra-3665PB |
Availability |
Protein Name: | Fra a 1 |
Source: | E.coli |
Species: | Strawberry |
MW: | 19.8 kDa |
Tag: | His |
Formulation: | Liquid in 50mM Tris, 300mM NaCl,pH 8.0 |
Purity: | >90% by SDS-PAGE |
Storage: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration: | 0.6mg/mL |
UniProt: | Q5ULZ4 |
Product Description: | Recombinant biotinylation Fra a 1 was expressed in E.coli with N-terminal His tag. |
Sequence: | MGSSHHHHHHSSGLVPRGSHMMGVFTYETEFTSVIPPPRLFKAFILDADNLIPKIAPQAVKCAEIIEGDGGVGTIKKITFGEGSQFGSVTHKIDGIDKDNFAYSYSLVEGDALSDKIEKISYETKLVASSDGGSVIKSTSNYHTKGDVEIKEEHVKAGKEKASHLFKLVEDYLLANPNEYC |
Catalog# | Product Name | Inquiry |
---|---|---|
ra-3665P | Recombinant Fra a 1 | Inquiry |
ra-3666P | Recombinant Fra a 3 | Inquiry |
ra-3667P | Recombinant Fra a 4 | Inquiry |
ra-3668P | Recombinant Fra e 1 | Inquiry |
ra-3509P | Recombinant Act c 5 | Inquiry |
ra-3517P | Recombinant Act d 6 | Inquiry |
ra-3516P | Recombinant Act d 5 | Inquiry |
ra-3514P | Recombinant Act d 3 | Inquiry |
ra-3513P | Recombinant Act d 2 | Inquiry |
ra-3512P | Recombinant Act d 1 | Inquiry |
ra-3511P | Recombinant Act c 10 | Inquiry |
ra-3510P | Recombinant Act c 8 | Inquiry |
ra-3722PB | Recombinant Mal d 2, Biotin Labeled | Inquiry |
ra-3445P | Recombinant Mus a 4 | Inquiry |
ra-3444P | Recombinant Mus a 6 | Inquiry |
ra-3443P | Recombinant Mus a 5 | Inquiry |
ra-3442P | Recombinant Mus a 1 | Inquiry |
ra-3441P | Recombinant Mus a 3 | Inquiry |
ra-3440P | Recombinant Mus a 2 | Inquiry |
ra-3409P | Recombinant Coc n 1 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools