| Cat.No. | RA-3166A |
| Availability |
| Source: | E.coli |
| ShortName: | Gly d 2, C-His tagged |
| similar: | Gly d 2 |
| Tag: | C-His |
| Product Overview: | Recombinant Gly d 2 Protein with C-His tag was expressed in E.coli. |
| Form: | Sterile 50mM Tris, 300mM NaCl, pH7.5, 0.1% SKL |
| Molecular Mass: | 15 kDa |
| AASequence: | MGKMNFTDCGHNEIKELSVSNCTGNYCVIHRGKPLTLDAKFDANQDTASVGLVLTAIIDGDIAIDIPGLETNACKLMKCPIRKGEHQELIYNIGEIPDATPEIKAKVKAQLIGEHGVLACGWVDGEVQEHHHHHHHH |
| Purity: | > 90% by SDS-PAGE |
| StoRAge: | Store it under sterile conditions at -20 to -80 centigRAde. It is recommended that the protein be aliquoted for optimal stoRAge. Avoid repeated freeze-thaw cycles. |
| ConcentRAtion: | 0.97 mg/mL by BCA |
| Official Symbol: | Gly d 2 |
|
Figure Title 1: SDS-PAGE and WB
Figure Note 1: Reducing 4%-20% SDS-PAGE (CBB stained) and WB (Anti-His Mouse Monoclonal antibody) analysis profiles of purified Gly d 2 1. Gly d 2 2. BSA |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| RA-3669P | Recombinant Gly m 1 | Inquiry |
| RA-3670P | Recombinant Gly m 2 | Inquiry |
| RA-3676P | Recombinant Gly m 8 | Inquiry |
| RA-3676PB | Recombinant Gly m 8, Biotin Labeled | Inquiry |
| RA-3672PE | Recombinant Gly m 4 | Inquiry |
| RA-3674P | Recombinant Gly m 6 Protein, C-His tagged | Inquiry |
| RA-3671P | Recombinant Gly m 3 | Inquiry |
| RA-3675P | Recombinant Gly m 7 | Inquiry |
| RA-3672P | Recombinant Gly m 4 | Inquiry |
| RA-3673P | Recombinant Gly m 5 | Inquiry |
| RA-3672PB | Recombinant Gly m 4, Biotin Labeled | Inquiry |
| RA-3051A | Recombinant Blo t 11 | Inquiry |
| RA-3054A | Recombinant Blo t 19 | Inquiry |
| RA-3053A | Recombinant Blo t 13 | Inquiry |
| RA-3052A | Recombinant Blo t 12 | Inquiry |
| RA-3049A | Recombinant Blo t 8 | Inquiry |
| RA-3048A | Recombinant Blo t 7 | Inquiry |
| RA-3046A | Recombinant Blo t 5 | Inquiry |
| RA-3045A | Recombinant Blo t 4 | Inquiry |
| na-3083APB | Native Purified Der f 1, Biotin Labeled | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools