| Cat.No. | ra-3674P |
| Availability |
| Source: | E.coli |
| ShortName: | Gly m 6, C-His tagged |
| similar: | Gly m 6 |
| Tag: | C-His |
| Protein length: | 20-495 aa |
| Product Overview: | Recombinant Gly m 6 Protein with C-His tag was expressed in E.coli. |
| Form: | Sterile 50mM Tris, pH7.5, 300mM NACl, 0.1% SKL |
| Molecular Mass: | 55 kDa |
| AASequence: | MFSSREQPQQNECQIQKLNALKPDNRIESEGGLIETWNPNNKPFQCAGVALSRCTLNRNALRRPSYTNGPQEIYIQQGKGIFGMIYPGCPSTFEEPQQPQQRGQSSRPQDRHQKIYNFREGDLIAVPTGVAWWMYNNEDTPVVAVSIIDTNSLENQLDQMPRRFYLAGNQEQEFLKYQQEQGGHQSQKGKHQQEEENEGGSILSGFTLEFLEHAFSVDKQIAKNLQGENEGEDKGAIVTVKGGLSVIKPPTDEQQQRPQEEEEEEEDEKPQCKGKDKHCQRPRGSQSKSRRNGIDETICTMRLRHNIGQTSSPDIYNPQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRALIQVVNCNGERVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANSLLNALPEEVIQHTFNLKSQQARQIKNNNPFKFLVPPQESQKRAVAHHHHHHHH |
| Purity: | > 90% by SDS-PAGE |
| Storage: | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration: | 0.73 mg/mL by BCA |
| Official Symbol: | Gly m 6 |
|
Figure Title 1: SDS-PAGE and WB
Figure Note 1: Reducing 4%-20% SDS-PAGE (CBB stained) and WB (Anti-His Mouse Monoclonal antibody) analysis profiles of purified Gly m 6 1. Gly m 6: 1 μg 2. BSA: 1 μg |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| ra-3669P | Recombinant Gly m 1 | Inquiry |
| ra-3670P | Recombinant Gly m 2 | Inquiry |
| ra-3676P | Recombinant Gly m 8 | Inquiry |
| ra-3676PB | Recombinant Gly m 8, Biotin Labeled | Inquiry |
| ra-3672PE | Recombinant Gly m 4 | Inquiry |
| ra-3673P | Recombinant Gly m 5 | Inquiry |
| ra-3671P | Recombinant Gly m 3 | Inquiry |
| ra-3675P | Recombinant Gly m 7 | Inquiry |
| ra-3672P | Recombinant Gly m 4 | Inquiry |
| ra-3166A | Recombinant Gly d 2 Protein, C-His tagged | Inquiry |
| ra-3672PB | Recombinant Gly m 4, Biotin Labeled | Inquiry |
| ra-3603P | Recombinant Bra n 1 | Inquiry |
| ra-3606P | Recombinant Bra r 2 | Inquiry |
| ra-3605P | Recombinant Bra r 1 | Inquiry |
| ra-3604P | Recombinant Bra o 3 | Inquiry |
| ra-3594P | Recombinant Beta v 2 | Inquiry |
| ra-3593P | Recombinant Beta v 1 | Inquiry |
| ra-3552P | Recombinant Api g 5 | Inquiry |
| ra-3551P | Recombinant Api g 4 | Inquiry |
| ra-3549P | Recombinant Api g 2 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools