Cat.No. | ra-3182A |
Availability | |
Size | 1mg |
Price | $ |
Qty |
Source: | E.coli |
Species: | Litopenaeus vannamei (White shrimp) |
Description: | Recombinant Lit v 4 was expressed in E.coli with C-His tag. |
MW: | 23 kDa |
Tag: | His |
Formulation: | Sterile 50mM Tris, 300mM NaCl, pH 8.0 |
Purity: | >90% by SDS-PAGE |
Storage: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration: | 0.5-1.0mg/mL |
Sequence: | MAYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLAVRNTLIEGRGEFSADAYANNQKIMRNLWNEIAELADFNKDGEVTVDEFKQAVQKHCQGKKYGDFPGAFKVFIANQFKAIDVNGDGKVGLDEYRLDCITRSAFAEVKEIDDAYNKLTTEDDRKAGGLTLERYQDLYAQFISNPDESCSACYLFGPLKVVQHHHHHH |
GenBank Protein: | ACM89179 |
UniProt: | C7A639 |
Catalog# | Product Name | Inquiry |
---|---|---|
ra-3181A | Recombinant Lit v 3 | Inquiry |
ra-3715P | Recombinant Lit c 1 | Inquiry |
ra-3180A | Recombinant Lit v 2 | Inquiry |
ra-3179A | Recombinant Lit v 1 | Inquiry |
ra-3184A | Recombinant Mel l 1 | Inquiry |
ra-3074A | Recombinant Cra c 1 | Inquiry |
ra-3197AB | Recombinant Pen m 4, Biotin Labeled | Inquiry |
ra-3195A | Recombinant Pen m 2 | Inquiry |
ra-3194A | Recombinant Pen m 1 | Inquiry |
ra-3193A | Recombinant Pen i 1 | Inquiry |
ra-3192A | Recombinant Pen a 1 | Inquiry |
ra-3190A | Recombinant Pan b 1 | Inquiry |
ra-3185A | Recombinant Met e 1 | Inquiry |
ra-3077A | Recombinant Cra c 5 | Inquiry |
ra-3183A | Recombinant Mac r 1 | Inquiry |
ra-3030A | Recombinant Art fr 5 | Inquiry |
ra-3075A | Recombinant Cra c 2 | Inquiry |
ra-3076A | Recombinant Cra c 4 | Inquiry |
ra-3162A | Recombinant Exo m 1 | Inquiry |
ra-3088A | Recombinant Cra c 6 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools