| Cat.No. | ra-3182A |
| Availability | |
| Size | 1mg |
| Price | $ |
| Qty |
| Source: | E.coli |
| ShortName: | Lit v 4, C-His tagged |
| similar: | Lit v 4 |
| Tag: | C-His |
| Product Overview: | Recombinant Lit v 4 Protein with C-His tag was expressed in E.coli. |
| Form: | Sterile 50mM Tris, 300mM NaCl, pH8.0 |
| Molecular Mass: | 22.9 kDa |
| AASequence: | MAYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLAVRNTLIEGRGEFSADAYANNQKIMRNLWNEIAELADFNKDGEVTVDEFKQAVQKHCQGKKYGDFPGAFKVFIANQFKAIDVNGDGKVGLDEYRLDCITRSAFAEVKEIDDAYNKLTTEDDRKAGGLTLERYQDLYAQFISNPDESCSACYLFGPLKVVQHHHHHH |
| Endotoxin: | < 1 EU/μg by LAL |
| Purity: | > 90% by SDS-PAGE |
| Storage: | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration: | 17.3 mg/mL |
| Official Symbol: | Lit v 4 |
|
Figure Title 1: SDS-PAGE and WB
Figure Note 1: Reducing 12% SDS-PAGE (CBB stained) and WB (Anti-His Mouse Monoclonal Antibody) analysis profiles of purified Lit v 4. 1. Lit v 4 2. BSA |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| ra-3181A | Recombinant Lit v 3 | Inquiry |
| ra-3715P | Recombinant Lit c 1 | Inquiry |
| ra-3180A | Recombinant Lit v 2 | Inquiry |
| ra-3179A | Recombinant Lit v 1 | Inquiry |
| ra-3184A | Recombinant Mel l 1 | Inquiry |
| ra-3074A | Recombinant Cra c 1 | Inquiry |
| ra-3197AB | Recombinant Pen m 4, Biotin Labeled | Inquiry |
| ra-3195A | Recombinant Pen m 2 Protein, C-His tagged | Inquiry |
| ra-3194A | Recombinant Pen m 1 | Inquiry |
| ra-3193A | Recombinant Pen i 1 | Inquiry |
| ra-3192A | Recombinant Pen a 1 | Inquiry |
| ra-3190A | Recombinant Pan b 1 | Inquiry |
| ra-3185A | Recombinant Met e 1 | Inquiry |
| ra-3077A | Recombinant Cra c 5 | Inquiry |
| ra-3183A | Recombinant Mac r 1 | Inquiry |
| ra-3030A | Recombinant Art fr 5 | Inquiry |
| ra-3075A | Recombinant Cra c 2 | Inquiry |
| ra-3076A | Recombinant Cra c 4 | Inquiry |
| ra-3162A | Recombinant Exo m 1 | Inquiry |
| ra-3088A | Recombinant Cra c 6 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools