| Cat.No. | ra-3722P |
| Availability | |
| Size | 500ug |
| Price | $ |
| Qty |
| Source: | E.coli |
| ShortName: | Mal d 2, N-His tagged |
| similar: | Mal d 2 |
| Tag: | N-His |
| Product Overview: | Recombinant Mal d 2 Protein with N-His tag was expressed in E.coli. |
| Form: | 50mM Tris, 0.3 M NaCl, pH 7.5 |
| Molecular Mass: | 25.5 kDa |
| AASequence: | MGSSHHHHHHSSGLVPRGSHMAKITFTNNCPNTVWPGTLTGDQKPQLSLTGFELASKASRSVDAPSPWSGRFWGRTRCSTDAAGKFTCETADCGSGQVACNGAGAVPPATLVEITIAANGGQDYYDVSLVDGFNLPMSVAPQGGTGECKPSSCPANVNKVCPAPLQVKAADGSVISCKSACLAFGDSKYCCTPPNNTPETCPPTEYSEIFEKQCPQAYSYAYDDKNSTFTCSGGPDYVITFCP |
| Purity: | > 90% by SDS-PAGE |
| Storage: | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration: | 0.654 mg/mL |
| Official Symbol: | Mal d 2 |
|
Figure Title 1: SDS-PAGE and WB
Figure Note 1: Reducing 12% SDS-PAGE and WB analysis profiles of purified Mald2 |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| ra-3722PB | Recombinant Mal d 2, Biotin Labeled | Inquiry |
| ra-3972F | Recombinant Mala s 13 | Inquiry |
| ra-3721P | Recombinant Mal d 1 | Inquiry |
| ra-3723P | Recombinant Mal d 3 | Inquiry |
| ra-3966F | Recombinant Mala s 7 | Inquiry |
| ra-3967F | Recombinant Mala s 8 | Inquiry |
| ra-3724P | Recombinant Mal d 4 Protein, N-His tagged | Inquiry |
| ra-3963F | Recombinant Mala s 1 | Inquiry |
| ra-3965F | Recombinant Mala s 6 | Inquiry |
| ra-3971F | Recombinant Mala s 12 | Inquiry |
| ra-3724PB | Recombinant Mal d 4, Biotin Labeled | Inquiry |
| ra-3961F | Recombinant Mala f 3 | Inquiry |
| ra-3960F | Recombinant Mala f 2 | Inquiry |
| ra-3969F | Recombinant Mala s 10 | Inquiry |
| ra-3970F | Recombinant Mala s 11 | Inquiry |
| ra-3962F | Recombinant Mala f 4 | Inquiry |
| ra-3723PB | Recombinant Mal d 3, Biotin Labeled | Inquiry |
| ra-3964F | Recombinant Mala s 5 | Inquiry |
| ra-3968F | Recombinant Mala s 9 | Inquiry |
| ra-3721PB | Recombinant Mal d 1, Biotin Labeled | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools