Cat.No. | ra-3729PB |
Availability |
Protein Name: | Ole e 2 |
Source: | E.coli |
Species: | Olive |
MW: | 16.7 kDa |
Tag: | His |
Formulation: | Liquid in PBS Buffer, pH 7.4 |
Purity: | >90% by SDS-PAGE |
Storage: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration: | 0.74mg/mL |
GenBank Protein: | CAA73035 |
UniProt: | O24169 |
Product Discription: | Recombinant biotinylation Ole e 2 was expressed in E.coli with N-terminal His tag. |
Sequence: | MGSSHHHHHHSSGLVPRGSHMMSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLLEQGL |
Catalog# | Product Name | Inquiry |
---|---|---|
ra-3729P | Recombinant Ole e 2 | Inquiry |
ra-3730P | Recombinant Ole e 3 | Inquiry |
ra-3740P | Recombinant Ole e 13 | Inquiry |
ra-3739P | Recombinant Ole e 12 | Inquiry |
ra-3738P | Recombinant Ole e 11 | Inquiry |
ra-3737P | Recombinant Ole e 10 | Inquiry |
ra-3736P | Recombinant Ole e 9 | Inquiry |
ra-3735P | Recombinant Ole e 8 | Inquiry |
ra-3734P | Recombinant Ole e 7,partial | Inquiry |
ra-3733P | Recombinant Ole e 6 | Inquiry |
ra-3732P | Recombinant Ole e 5 | Inquiry |
ra-3731P | Recombinant Ole e 4 | Inquiry |
ra-3734PB | Recombinant Ole e 7,partial, Biotin Labeled | Inquiry |
ra-3728P | Recombinant Ole e 1 | Inquiry |
ra-3741P | Recombinant Ole e 14 | Inquiry |
ra-3742P | Recombinant Ole e 15 | Inquiry |
ra-3728PB | Recombinant Ole e 1, Biotin Labeled | Inquiry |
ra-3732PB | Recombinant Ole e 5, Biotin Labeled | Inquiry |
ra-3678P | Recombinant Hel a 2 | Inquiry |
ra-3677P | Recombinant Hel a 1 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools