Recombinant Ole e 2

Protein Name:	Ole e 2
Source:	E.coli
Species:	Olive
Description:	Recombinant Ole e 2 was expressed in E.coli with N-terminal His tag.
MW:	16.7 kDa
Tag:	His
Formulation:	Liquid in PBS Buffer, pH 7.4
Purity:	>90% by SDS-PAGE
Storage:	Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration:	0.74mg/mL
GenBank Protein:	CAA73035
UniProt:	O24169
Sequence:	MGSSHHHHHHSSGLVPRGSHMMSWQAYVDDHLMCDIEGHEGHRLTAAAIVGHDGSVWAQSATFPQFKPEEMNGIMTDFNEPGHLAPTGLHLGGTKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLLEQGL

Catalog#	Product Name	Inquiry
ra-3729PB	Recombinant Ole e 2, Biotin Labeled	Inquiry
ra-3731P	Recombinant Ole e 4	Inquiry
ra-3741P	Recombinant Ole e 14	Inquiry
ra-3740P	Recombinant Ole e 13	Inquiry
ra-3739P	Recombinant Ole e 12	Inquiry
ra-3738P	Recombinant Ole e 11	Inquiry
ra-3737P	Recombinant Ole e 10	Inquiry
ra-3736P	Recombinant Ole e 9	Inquiry
ra-3735P	Recombinant Ole e 8	Inquiry
ra-3734P	Recombinant Ole e 7,partial	Inquiry
ra-3733P	Recombinant Ole e 6	Inquiry
ra-3732P	Recombinant Ole e 5	Inquiry
ra-3734PB	Recombinant Ole e 7,partial, Biotin Labeled	Inquiry
ra-3730P	Recombinant Ole e 3	Inquiry
ra-3728P	Recombinant Ole e 1	Inquiry
ra-3742P	Recombinant Ole e 15	Inquiry
ra-3728PB	Recombinant Ole e 1, Biotin Labeled	Inquiry
ra-3732PB	Recombinant Ole e 5, Biotin Labeled	Inquiry
ra-3678P	Recombinant Hel a 2	Inquiry
ra-3677P	Recombinant Hel a 1	Inquiry

Cat.No.	ra-3729P
Availability

Specification