Recombinant Par j 2 Protein, C-His tagged

Source:	Pichia pastoris
ShortName:	Par j 2, C-His tagged
similar:	Par j 2
Tag:	C-His
Protein length:	32-133 aa
Product Overview:	Recombinant Par j 2 Protein with C-His tag was expressed in Pichia pastoris.
Form:	Sterile 20mM PB, pH6.0, 250mM NaCl
Molecular Mass:	13 kDa
AASequence:	EAEAEEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLPPITADFDCSKIQSTIFRGYYHHHHHHHH
Purity:	> 90% by SDS-PAGE
StoRAge:	Store it under sterile conditions at -20 to -80 centigRAde. It is recommended that the protein be aliquoted for optimal stoRAge. Avoid repeated freeze-thaw cycles.
ConcentRAtion:	0.88 mg/mL by BCA
Official Symbol:	Par j 2
	Figure Title 1: SDS-PAGE and WB Figure Note 1: Reducing 4%-20% SDS-PAGE (CBB stained) and WB (Anti-His Mouse Monoclonal antibody) analysis profiles of purified Par j 2 1. Par j 2: 1 μg 2. BSA: 1 μg

Catalog#	Product Name	Inquiry
RA-3745PB	Recombinant Par j 2, Biotin Labeled	Inquiry
RA-3745PM	Recombinant Par j 2	Inquiry
RA-3744P	Recombinant Par j 1	Inquiry
RA-3746P	Recombinant Par j 3	Inquiry
RA-3747P	Recombinant Par j 4	Inquiry
RA-3748P	Recombinant Par h 1	Inquiry
RA-3749P	Recombinant Par o 1	Inquiry
RA-3010A	Recombinant Aed a 11	Inquiry
RA-3018A	Recombinant Api m 3	Inquiry
RA-3017A	Recombinant Api m 2	Inquiry
RA-3014A	Recombinant Api c 1	Inquiry
RA-3013A	Recombinant Ano d 2	Inquiry
RA-3012A	Recombinant Aed al 3	Inquiry
RA-3011A	Recombinant Aed al 2	Inquiry
RA-3008A	Recombinant Aed a 8	Inquiry
RA-3007A	Recombinant Aed a 7	Inquiry
RA-3005A	Recombinant Aed a 5	Inquiry
RA-3004A	Recombinant Aed a 4	Inquiry
RA-3123AMB	Recombinant Der p 2, Biotin Labeled	Inquiry
RA-3002A	Recombinant Aed a 2	Inquiry

Cat.No.	RA-3745P
Availability

Specification