| Cat.No. | RA-3745P |
| Availability |
| Source: | Pichia pastoris |
| ShortName: | Par j 2, C-His tagged |
| similar: | Par j 2 |
| Tag: | C-His |
| Protein length: | 32-133 aa |
| Product Overview: | Recombinant Par j 2 Protein with C-His tag was expressed in Pichia pastoris. |
| Form: | Sterile 20mM PB, pH6.0, 250mM NaCl |
| Molecular Mass: | 13 kDa |
| AASequence: | EAEAEEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLPPITADFDCSKIQSTIFRGYYHHHHHHHH |
| Purity: | > 90% by SDS-PAGE |
| StoRAge: | Store it under sterile conditions at -20 to -80 centigRAde. It is recommended that the protein be aliquoted for optimal stoRAge. Avoid repeated freeze-thaw cycles. |
| ConcentRAtion: | 0.88 mg/mL by BCA |
| Official Symbol: | Par j 2 |
|
Figure Title 1: SDS-PAGE and WB
Figure Note 1: Reducing 4%-20% SDS-PAGE (CBB stained) and WB (Anti-His Mouse Monoclonal antibody) analysis profiles of purified Par j 2 1. Par j 2: 1 μg 2. BSA: 1 μg |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| RA-3745PB | Recombinant Par j 2, Biotin Labeled | Inquiry |
| RA-3745PM | Recombinant Par j 2 | Inquiry |
| RA-3744P | Recombinant Par j 1 | Inquiry |
| RA-3746P | Recombinant Par j 3 | Inquiry |
| RA-3747P | Recombinant Par j 4 | Inquiry |
| RA-3748P | Recombinant Par h 1 | Inquiry |
| RA-3749P | Recombinant Par o 1 | Inquiry |
| RA-3421P | Recombinant Dac g 2 | Inquiry |
| RA-3436P | Recombinant Lol p 4 | Inquiry |
| RA-3435P | Recombinant Lol p 1 | Inquiry |
| RA-3425P | Recombinant Hol l 1 | Inquiry |
| RA-3424P | Recombinant Fes p 4 | Inquiry |
| RA-3423P | Recombinant Dac g 4 | Inquiry |
| RA-3422P | Recombinant Dac g 5 | Inquiry |
| RA-3419P | Recombinant Dac g 1 | Inquiry |
| RA-3418P | Recombinant Cyn d 24 | Inquiry |
| RA-3416P | Recombinant Cyn d 22 | Inquiry |
| RA-3415P | Recombinant Cyn d 15 | Inquiry |
| RA-3414P | Recombinant Cyn d 12 | Inquiry |
| RA-3413P | Recombinant Cyn d 7 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools