Recombinant Pla a 2, Biotin Labeled

Protein Name:	Pla a 2
Source:	Yeast
Species:	London plane tree
MW:	43kDa
Tag:	His
Formulation:	Liquid in PBS Buffer
Purity:	>90% by SDS-PAGE
Storage:	Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration:	1.0mg/mL
GenBank Protein:	CAE52833
UniProt:	Q6H9K0
Product Discription:	Recombinant biotinylation Pla a 2 was expressed in Pichia pastoris with His tag.
Sequence:	SGSVFNVNDYGAKGAGDISQAVMKAWKAACASQGPSTVLIPKGNYNMGEVAMQGPCKGSKIGFQIDGVVKAPADPSKFKSDGWVSFYRIDGLTVSGTGTLDGQGQTAWAKNNCDKNPNCKHAAMNLRFDFLKHAMVRDITSLNSKMFHINVLECEDITFQHVTVTAPGTSINTDGIHVGISKGVTITNTKIATGDDCISIGPGSQNVTITQVNCGPGHGISIGSLGRYNNEKEVRGITVKGCTFSGTMNGVRVKTWPNSPPGAATDLTFQDLTMNNVQNPVILDQEYCPYGQCSRQAPSRIKLSNINFNNIRGTSTGKVAVVIACSHGMPCSNMKIGEINLSYRGAGGPATSTCSNVKPTFSGKQVPAIKCA

Catalog#	Product Name	Inquiry
ra-3763PM	Recombinant Pla a 2	Inquiry
ra-3763P	Recombinant Pla a 2	Inquiry
ra-3760P	Recombinant Pla l 1	Inquiry
ra-3767P	Recombinant Pla or 3	Inquiry
ra-3761P	Recombinant Pla l 2	Inquiry
ra-3764PB	Recombinant Pla a 3, Biotin Labeled	Inquiry
ra-3765P	Recombinant Pla or 2	Inquiry
ra-3760PB	Recombinant Pla l 1, Biotin Labeled	Inquiry
ra-3764P1	Recombinant Pla a 3.02	Inquiry
ra-3764P	Recombinant Pla a 3	Inquiry
ra-3762P	Recombinant Pla a 1	Inquiry
ra-3766P	Recombinant Pla or 1	Inquiry
ra-3762PB	Recombinant Pla a 1, Biotin Labeled	Inquiry
ra-3601P	Recombinant Bet v 8	Inquiry
ra-3637P	Recombinant Cof a 2	Inquiry
ra-3636P	Recombinant Cof a 1	Inquiry
ra-3616P	Recombinant Car b 1	Inquiry
ra-3598P	Recombinant Bet v 4	Inquiry
ra-3596P	Recombinant Bet v 2	Inquiry
ra-3595P	Recombinant Bet v 1	Inquiry

Cat.No.	ra-3763PB
Availability

Specification