Protein Name: | Pla a 2 |
Cat#: | ra-3763PB |
Product Name: | Recombinant Pla a 2, Biotin Labeled |
Source: | Yeast |
Species: | London plane tree |
MW: | 43kDa |
Tag: | His |
Formulation: | Liquid in PBS Buffer |
Purity: | >90% by SDS-PAGE |
Storage: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration: | 1.0mg/mL |
GenBank Protein: | CAE52833 |
UniProt: | Q6H9K0 |
Product Discription: | Recombinant biotinylation Pla a 2 was expressed in Pichia pastoris with His tag. |
Sequence: | SGSVFNVNDYGAKGAGDISQAVMKAWKAACASQGPSTVLIPKGNYNMGEVAMQGPCKGSKIGFQIDGVVKAPADPSKFKSDGWVSFYRIDGLTVSGTGTLDGQGQTAWAKNNCDKNPNCKHAAMNLRFDFLKHAMVRDITSLNSKMFHINVLECEDITFQHVTVTAPGTSINTDGIHVGISKGVTITNTKIATGDDCISIGPGSQNVTITQVNCGPGHGISIGSLGRYNNEKEVRGITVKGCTFSGTMNGVRVKTWPNSPPGAATDLTFQDLTMNNVQNPVILDQEYCPYGQCSRQAPSRIKLSNINFNNIRGTSTGKVAVVIACSHGMPCSNMKIGEINLSYRGAGGPATSTCSNVKPTFSGKQVPAIKCA |
Catalog# | Product Name | Inquiry |
---|---|---|
ra-3763PM | Recombinant Pla a 2 | Inquiry |
ra-3763P | Recombinant Pla a 2 | Inquiry |
ra-3760P | Recombinant Pla l 1 | Inquiry |
ra-3767P | Recombinant Pla or 3 | Inquiry |
ra-3761P | Recombinant Pla l 2 | Inquiry |
ra-3764PB | Recombinant Pla a 3, Biotin Labeled | Inquiry |
ra-3765P | Recombinant Pla or 2 | Inquiry |
ra-3760PB | Recombinant Pla l 1, Biotin Labeled | Inquiry |
ra-3764P1 | Recombinant Pla a 3.02 | Inquiry |
ra-3764P | Recombinant Pla a 3 | Inquiry |
ra-3762P | Recombinant Pla a 1 | Inquiry |
ra-3766P | Recombinant Pla or 1 | Inquiry |
ra-3762PB | Recombinant Pla a 1, Biotin Labeled | Inquiry |
ra-3601P | Recombinant Bet v 8 | Inquiry |
ra-3637P | Recombinant Cof a 2 | Inquiry |
ra-3636P | Recombinant Cof a 1 | Inquiry |
ra-3616P | Recombinant Car b 1 | Inquiry |
ra-3598P | Recombinant Bet v 4 | Inquiry |
ra-3596P | Recombinant Bet v 2 | Inquiry |
ra-3595P | Recombinant Bet v 1 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools