| Cat.No. | RA-3763P |
| Availability |
| Protein Name: | Pla a 2 |
| Source: | Yeast |
| Species: | London plane 47 |
| Description: | Recombinant Pla a 2 was expressed in Pichia pastoris with His tag. |
| MW: | 43kDa |
| Tag: | His |
| Formulation: | Liquid in PBS Buffer |
| Purity: | >90% by SDS-PAGE |
| StoRAge: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal stoRAge. Avoid repeated freeze-thaw cycles. |
| ConcentRAtion: | 1.0mg/mL |
| GenBank Protein: | CAE52833 |
| UniProt: | Q6H9K0 |
| Sequence: | SGSVFNVNDYGAKGAGDISQAVMKAWKAACASQGPSTVLIPKGNYNMGEVAMQGPCKGSKIGFQIDGVVKAPADPSKFKSDGWVSFYRIDGLTVSGTGTLDGQGQTAWAKNNCDKNPNCKHAAMNLRFDFLKHAMVRDITSLNSKMFHINVLECEDITFQHVTVTAPGTSINTDGIHVGISKGVTITNTKIATGDDCISIGPGSQNVTITQVNCGPGHGISIGSLGRYNNEKEVRGITVKGCTFSGTMNGVRVKTWPNSPPGAATDLTFQDLTMNNVQNPVILDQEYCPYGQCSRQAPSRIKLSNINFNNIRGTSTGKVAVVIACSHGMPCSNMKIGEINLSYRGAGGPATSTCSNVKPTFSGKQVPAIKCA |
| SDS-PAGE(Picture): | RA-3763P, 1 |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| RA-3763PM | Recombinant Pla a 2 | Inquiry |
| RA-3763PB | Recombinant Pla a 2, Biotin Labeled | Inquiry |
| RA-3760P | Recombinant Pla l 1 | Inquiry |
| RA-3761P | Recombinant Pla l 2 | Inquiry |
| RA-3764PB | Recombinant Pla a 3, Biotin Labeled | Inquiry |
| RA-3766P | Recombinant Pla or 1 | Inquiry |
| RA-3760PB | Recombinant Pla l 1, Biotin Labeled | Inquiry |
| RA-3764P1 | Recombinant Pla a 3.02 | Inquiry |
| RA-3764P | Recombinant Pla a 3 | Inquiry |
| RA-3765P | Recombinant Pla or 2 | Inquiry |
| RA-3762P | Recombinant Pla a 1 | Inquiry |
| RA-3767P | Recombinant Pla or 3 | Inquiry |
| RA-3762PB | Recombinant Pla a 1, Biotin Labeled | Inquiry |
| RA-3010A | Recombinant Aed a 11 | Inquiry |
| RA-3013A | Recombinant Ano d 2 | Inquiry |
| RA-3012A | Recombinant Aed al 3 | Inquiry |
| RA-3011A | Recombinant Aed al 2 | Inquiry |
| RA-3123AMB | Recombinant Der p 2, Biotin Labeled | Inquiry |
| RA-3005A | Recombinant Aed a 5 | Inquiry |
| RA-3004A | Recombinant Aed a 4 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools