| Cat.No. | RA-3548PB |
| Availability |
| Protein Name: | Api g 1 |
| Source: | E.coli |
| Species: | Celery |
| Description: | Recombinant biotinylation Api g 1 was expressed in E.coli with N-terminal His tag. |
| MW: | 18.5 kDa |
| Tag: | His |
| Formulation: | 50 mM Tris-HCl, 300 mM NaCl (pH 7.5) |
| Purity: | >90% by SDS-PAGE |
| StoRAge: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal stoRAge. Avoid repeated freeze-thaw cycles. |
| ConcentRAtion: | 1.44mg/mL |
| GenBank Protein: | CAA88831 |
| UniProt: | P49372 |
| Sequence: | MGSSHHHHHHSSGLVPRGSHMGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEIKGDGGPGTLKIITLPDGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIFHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN |
| Catalog# | Product Name | Inquiry |
|---|---|---|
| RA-3548PE2 | Recombinant Api g 1, isoallergen 2 | Inquiry |
| RA-3548PE1 | Recombinant Api g 1, isoallergen 1 | Inquiry |
| RA-3548PE1B | Recombinant Api g 1, isoallergen 1, Biotin Labeled | Inquiry |
| RA-3548P | Recombinant Api g 1 | Inquiry |
| RA-3548PE2B | Recombinant Api g 1, isoallergen 2, Biotin Labeled | Inquiry |
| RA-3550P | Recombinant Api g 3 | Inquiry |
| RA-3020A | Recombinant Api m 5 | Inquiry |
| RA-3019A | Recombinant Api m 4 | Inquiry |
| RA-3018A | Recombinant Api m 3 | Inquiry |
| RA-3017A | Recombinant Api m 2 | Inquiry |
| RA-3016A | Recombinant Api m 1 | Inquiry |
| RA-3014A | Recombinant Api c 1 | Inquiry |
| RA-3549P | Recombinant Api g 2 | Inquiry |
| RA-3553P | Recombinant Api g 6 | Inquiry |
| RA-3024A | Recombinant Api m 9 | Inquiry |
| RA-3022A | Recombinant Api m 7 | Inquiry |
| RA-3026A | Recombinant Api m 11 | Inquiry |
| RA-3552P | Recombinant Api g 5 | Inquiry |
| RA-3025A | Recombinant Api m 10 | Inquiry |
| RA-3551P | Recombinant Api g 4 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools