Recombinant Api g 1

Protein Name:	Api g 1
Source:	E.coli
Species:	Celery
MW:	18.5 kDa
Tag:	His
Formulation:	50 mM Tris-HCl, 300 mM NaCl (pH 7.5)
Purity:	>90% by SDS-PAGE
Storage:	Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration:	1.44mg/mL
GenBank Protein:	CAA88831
UniProt:	P49372
Sequence:	MGSSHHHHHHSSGLVPRGSHMGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEIKGDGGPGTLKIITLPDGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIFHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN

Catalog#	Product Name	Inquiry
ra-3548PE1	Recombinant Api g 1, isoallergen 1	Inquiry
ra-3548PE2	Recombinant Api g 1, isoallergen 2	Inquiry
ra-3548PB	Recombinant Api g 1, Biotin Labeled	Inquiry
ra-3548PE1B	Recombinant Api g 1, isoallergen 1, Biotin Labeled	Inquiry
ra-3548PE2B	Recombinant Api g 1, isoallergen 2, Biotin Labeled	Inquiry
ra-3024A	Recombinant Api m 9	Inquiry
ra-3553P	Recombinant Api g 6	Inquiry
ra-3552P	Recombinant Api g 5	Inquiry
ra-3550P	Recombinant Api g 3	Inquiry
ra-3549P	Recombinant Api g 2	Inquiry
ra-3027A	Recombinant Api m 12	Inquiry
ra-3026A	Recombinant Api m 11	Inquiry
ra-3025A	Recombinant Api m 10	Inquiry
ra-3022A	Recombinant Api m 7	Inquiry
ra-3021A	Recombinant Api m 6	Inquiry
ra-3019A	Recombinant Api m 4	Inquiry
ra-3018A	Recombinant Api m 3	Inquiry
ra-3017A	Recombinant Api m 2	Inquiry
ra-3016A	Recombinant Api m 1	Inquiry
ra-3015A	Recombinant Api d 1	Inquiry

Cat.No.	ra-3548P
Availability

Specification