Protein Name: | Api g 1 |
Cat#: | ra-3548P |
Product Name: | Recombinant Api g 1 |
Product Description: | Recombinant Api g 1 was expressed in E.coli with N-terminal His tag. |
Source: | E.coli |
Species: | Celery |
MW: | 18.5 kDa |
Tag: | His |
Formulation: | 50 mM Tris-HCl, 300 mM NaCl (pH 7.5) |
Purity: | >90% by SDS-PAGE |
Storage: | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration: | 1.44mg/mL |
GenBank Protein: | CAA88831 |
UniProt: | P49372 |
Sequence: | MGSSHHHHHHSSGLVPRGSHMGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEIKGDGGPGTLKIITLPDGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIFHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN |
Catalog# | Product Name | Inquiry |
---|---|---|
ra-3548PE1 | Recombinant Api g 1, isoallergen 1 | Inquiry |
ra-3548PE2 | Recombinant Api g 1, isoallergen 2 | Inquiry |
ra-3548PB | Recombinant Api g 1, Biotin Labeled | Inquiry |
ra-3548PE1B | Recombinant Api g 1, isoallergen 1, Biotin Labeled | Inquiry |
ra-3548PE2B | Recombinant Api g 1, isoallergen 2, Biotin Labeled | Inquiry |
ra-3024A | Recombinant Api m 9 | Inquiry |
ra-3553P | Recombinant Api g 6 | Inquiry |
ra-3552P | Recombinant Api g 5 | Inquiry |
ra-3550P | Recombinant Api g 3 | Inquiry |
ra-3549P | Recombinant Api g 2 | Inquiry |
ra-3027A | Recombinant Api m 12 | Inquiry |
ra-3026A | Recombinant Api m 11 | Inquiry |
ra-3025A | Recombinant Api m 10 | Inquiry |
ra-3022A | Recombinant Api m 7 | Inquiry |
ra-3021A | Recombinant Api m 6 | Inquiry |
ra-3019A | Recombinant Api m 4 | Inquiry |
ra-3018A | Recombinant Api m 3 | Inquiry |
ra-3017A | Recombinant Api m 2 | Inquiry |
ra-3016A | Recombinant Api m 1 | Inquiry |
ra-3015A | Recombinant Api d 1 | Inquiry |
Contact Us
Enter your email here to subscribe.
Follow us on
Easy access to products and services you need from our library via powerful searching tools