Filter By
Clear all Filters
Allergen Source
Allergen Species
Route of Allergen Exposure
Featured Products
Recombinant Api g 1
| Cat.No. |
ra-3548P |
| Availability |
|
Inquiry
Bulk Order
Online Order
Specification
Related Products
| Protein Name: |
Api g 1 |
| Source: |
E.coli |
| Species: |
Celery |
| MW: |
18.5 kDa |
| Tag: |
His |
| Formulation: |
50 mM Tris-HCl, 300 mM NaCl (pH 7.5) |
| Purity: |
>90% by SDS-PAGE |
| Storage: |
Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration: |
1.44mg/mL |
| GenBank Protein: |
CAA88831 |
| UniProt: |
P49372 |
| Sequence: |
MGSSHHHHHHSSGLVPRGSHMGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEIKGDGGPGTLKIITLPDGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIFHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN |
|
 |
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
